DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Emx2 and btn

DIOPT Version :10

Sequence 1:NP_034262.2 Gene:Emx2 / 13797 MGIID:95388 Length:253 Species:Mus musculus
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:67 Identity:35/67 - (52%)
Similarity:46/67 - (68%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse   156 KRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGS 220
            ::.|||||.:||.:||..|..::|:....|.::|.:|.|||.||||||||||.|.||.||||:..
  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQG 151

Mouse   221 DS 222
            .|
  Fly   152 SS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Emx2NP_034262.2 Homeodomain 156..212 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..253 5/10 (50%)
btnNP_732768.1 Homeodomain 87..143 CDD:459649 28/55 (51%)

Return to query results.
Submit another query.