DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Emx2 and zen2

DIOPT Version :10

Sequence 1:NP_034262.2 Gene:Emx2 / 13797 MGIID:95388 Length:253 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:88 Identity:35/88 - (39%)
Similarity:46/88 - (52%) Gaps:14/88 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse   152 ARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQ--- 213
            :.|.||.|||||..||:.||..|..|.|:....|.:::..|:|||.|||:||||||.|.|:.   
  Fly    40 SEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNR 104

Mouse   214 -----------KLEEEGSDSQQK 225
                       .|..:.|:..||
  Fly   105 KGAIGALTTSIPLSSQSSEDLQK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Emx2NP_034262.2 Homeodomain 156..212 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..253 4/27 (15%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 29/55 (53%)

Return to query results.
Submit another query.