DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Emx2 and lab

DIOPT Version :10

Sequence 1:NP_034262.2 Gene:Emx2 / 13797 MGIID:95388 Length:253 Species:Mus musculus
Sequence 2:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster


Alignment Length:58 Identity:29/58 - (50%)
Similarity:38/58 - (65%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse   159 RTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLE 216
            ||.|:..||..||..|..|.|:..|.|.::|::|.|.|||||:||||||.|.|::..|
  Fly   505 RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKE 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Emx2NP_034262.2 Homeodomain 156..212 CDD:459649 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..253 1/4 (25%)
labNP_476613.1 Homeodomain 505..558 CDD:459649 27/52 (52%)

Return to query results.
Submit another query.