DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Emx2 and bsh

DIOPT Version :10

Sequence 1:NP_034262.2 Gene:Emx2 / 13797 MGIID:95388 Length:253 Species:Mus musculus
Sequence 2:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster


Alignment Length:250 Identity:65/250 - (26%)
Similarity:83/250 - (33%) Gaps:78/250 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse    23 PASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAAGRGVYSNP---------------DLVF 72
            |:..|..|......|.:.|:......|...|..|....|:.::|.|               |.:.
  Fly   102 PSQHSHPPQSHPPASASASATATARSNQAASGYAGEDYGKSMHSTPRSNHHSRHGTSHYNGDQIS 166

Mouse    73 AE----AVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGH 133
            .:    |..|||.|.....|.|||               ||...........||    ...|..|
  Fly   167 QQLGSGAAQHPPVPTTQPQPPPPP---------------PLNGGSGASNGVLYP----NAPYTDH 212

Mouse   134 RF-----------QGNDTSPESFLLH----------------------------NALAR-KPKRI 158
            .|           .|...|.:.:.|.                            |||.. :.::.
  Fly   213 GFLQMTLGYLSPSSGTYKSVDPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKA 277

Mouse   159 RTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQ 213
            ||.||..||..||..||...|:...||.:||.:|.|:|||||.||||||.|.|:|
  Fly   278 RTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQ 332

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Emx2NP_034262.2 Homeodomain 156..212 CDD:459649 29/55 (53%)