DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Emx2 and Pph13

DIOPT Version :10

Sequence 1:NP_034262.2 Gene:Emx2 / 13797 MGIID:95388 Length:253 Species:Mus musculus
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:103 Identity:38/103 - (36%)
Similarity:56/103 - (54%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse   151 LARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKL 215
            :.||.:|.||.|:..||..||.||::.||.....|::||..:.|||.:|:|||||||.|:::|  
  Fly     6 MKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQ-- 68

Mouse   216 EEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD 253
            |:.|......|:|.               .::||:.||
  Fly    69 EKIGGLGGDYKEGA---------------LDLDVSYDD 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Emx2NP_034262.2 Homeodomain 156..212 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..253 7/39 (18%)
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 27/55 (49%)

Return to query results.
Submit another query.