DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PXDNL and Pxt

DIOPT Version :9

Sequence 1:NP_653252.4 Gene:PXDNL / 137902 HGNCID:26359 Length:1463 Species:Homo sapiens
Sequence 2:NP_650648.3 Gene:Pxt / 42131 FlyBaseID:FBgn0261987 Length:809 Species:Drosophila melanogaster


Alignment Length:739 Identity:232/739 - (31%)
Similarity:341/739 - (46%) Gaps:123/739 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   636 KPHTS-SDLLAQFHYPRDPLIVEMARA-----------------------GEIFE-------HTL 669
            ||.|| .:..:.|.....|.:::.||.                       |.:|.       |..
  Fly   115 KPETSPKERRSGFPTILSPAVLDEARRNFEHLMHGVAQIPVRRGFPDFAHGLVFHSTAKDDLHNF 179

Human   670 QLIRERVKQGLTVDLEGK-------EFRYNDLVSPRSLSLIANLSGCTARRPLPNCSNRCFHAKY 727
            .:....::|.:|..|.||       :|..|::  |...:.......|   :|.|.|.|  ..:.|
  Fly   180 AISNSAIEQVMTTQLFGKKEQVPVEDFITNNV--PIKFTETPLAHHC---QPPPVCGN--IRSVY 237

Human   728 RAHDGTCNN--LQQPTWGAALTAFARLLQPAYRDGIRAPRGL---GLP-VGSRQPLPPPRLVATV 786
            |:.||||||  .|:..||||.....|:|.|||.|||..||..   |.| :|:|      ::..|:
  Fly   238 RSMDGTCNNPEPQRSLWGAAGQPMERMLPPAYEDGIWTPRAHSSDGTPLLGAR------KISRTL 296

Human   787 WARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGR--PCSSVCTNDPPCFPMNTRH 849
            .:...  .|...|..|:|.:|..|.||:..|    |:.|..||.  .|         |.|.....
  Fly   297 LSDVD--RPHPKYNLMVMQFGQVLAHDISQT----SSIRLEDGSLVQC---------CSPEGKVA 346

Human   850 ADPRGTHAPCM---------LFARSSPAC-----ASGRPSATVDSVYAREQINQQTAYIDGSNVY 900
            ..|:.:|..||         .|:.....|     .|..||......|.: |:.:.|.::|.|.||
  Fly   347 LSPQQSHFACMPIHVEPDDEFFSAFGVRCLNFVRLSLVPSPDCQLSYGK-QLTKVTHFVDASPVY 410

Human   901 GSSERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQEQESPCFLAGDHRANEHL 965
            |||:..|::||.....|..:...|     |:.|||. |.....|..:|....||.:||.|.|:.:
  Fly   411 GSSDEASRSLRAFRGGRLRMMNDF-----GRDLLPL-TNDKKACPSEEAGKSCFHSGDGRTNQII 469

Human   966 ALAAMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRML 1030
            :|..:..|..|||||:|..|..|||.....|::||||:||.||:|||||:.:||.::|....:..
  Fly   470 SLITLQILLAREHNRVAGALHELNPSASDETLFQEARRIVIAEMQHITYNEFLPIIIGPQQMKRF 534

Human  1031 R------GY-RGYNPNVNAGIINSFATAAFRFGHTLINPILYRLNATLGEISE-GHLPFHKALFS 1087
            |      || ..||.|||..|.|.|:.||:|.||:.::. .:::....|.|.| .::|  ..:|:
  Fly   535 RLVPLHQGYSHDYNVNVNPAITNEFSGAAYRMGHSSVDG-KFQIRQEHGRIDEVVNIP--DVMFN 596

Human  1088 PSRIIKEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSAAYSAAVDSAATIIQRGRDHGIPP 1152
            |||:.|....|.:||.|:....:....|  :|..|::.||.......:|.||..||||||.|:..
  Fly   597 PSRMRKREFYDDMLRTLYSQPMQQVDSS--ISQGLSRFLFRGDNPFGLDLAAINIQRGRDQGLRS 659

Human  1153 YVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPALMVEDLIPGTRVGPTLMC 1217
            |.|:........:.:||..     ..||.|||.::|.:|.|||||...::|..:.|..||.|...
  Fly   660 YNDYLELMGAPKLHSFEQF-----PIEIAQKLSRVYRTPDDIDLWVGGLLEKAVEGGVVGVTFAE 719

Human  1218 LFVTQFQRLRDGDRFWYE-----NPGVFTPAQLTQLKQASLSRVLCDNGD--SIQQVQADVFVKA 1275
            :...||.|.:.|||::||     |||.|.|.||.::::.:|:|:||||.|  ::|.|....||:|
  Fly   720 IIADQFARFKQGDRYYYEYDNGINPGAFNPLQLQEIRKVTLARLLCDNSDRLTLQAVPLAAFVRA 784

Human  1276 EYP-QDYLNCSE--IPKVDLRVWQ 1296
            ::| ...:.|.:  :|.|:|..|:
  Fly   785 DHPGNQMIGCDDPNLPSVNLEAWR 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PXDNLNP_653252.4 LRR 1 51..72
leucine-rich repeat 52..85 CDD:275378
LRR_8 53..134 CDD:316378
LRR 2 75..96
leucine-rich repeat 86..123 CDD:275378
LRR 3 99..120
LRR_8 123..182 CDD:316378
LRR 4 123..144
leucine-rich repeat 124..147 CDD:275378
LRR 5 147..168
leucine-rich repeat 148..171 CDD:275378
leucine-rich repeat 172..184 CDD:275378
LRRCT 180..232 CDD:214507
Ig_3 234..309 CDD:316449
Ig_3 329..402 CDD:316449
Ig 432..505 CDD:325142
Ig 528..596 CDD:325142
peroxidasin_like 851..1286 CDD:188658 160/464 (34%)
VWC 1400..1450 CDD:214564
PxtNP_650648.3 GH64-TLP-SF <67..119 CDD:295337 2/3 (67%)
An_peroxidase 237..772 CDD:281139 197/572 (34%)
peroxinectin_like 396..767 CDD:188655 140/386 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3260
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D276568at2759
OrthoFinder 1 1.000 - - FOG0000202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.