DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NDUFAF6 and sicily

DIOPT Version :10

Sequence 1:NP_689629.2 Gene:NDUFAF6 / 137682 HGNCID:28625 Length:333 Species:Homo sapiens
Sequence 2:NP_572765.1 Gene:sicily / 32151 FlyBaseID:FBgn0030352 Length:334 Species:Drosophila melanogaster


Alignment Length:134 Identity:30/134 - (22%)
Similarity:43/134 - (32%) Gaps:51/134 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   702 PEQYKLTQSPEPLDLNKALSSIHAKNVFTMRLKSLQNLQSEKSSRTTLLVQLTFEGSRGPSY--- 763
            |||..|...|     |.....:..|..           :|:...|..:|||:  ||.  |.|   
  Fly    12 PEQQSLCSLP-----NSGCCHVDVKVG-----------RSKWEKRVAVLVQV--EGE--PDYKIY 56

Human   764 -----LPGEHLG------IFPGNQTGLVQGILERVVDC-----------SSPDQTVCLEVLDESG 806
                 |.|...|      |:|.|:      :.:|.|.|           |...:.:..:....:|
  Fly    57 IYTYFLKGLGAGKPLIGQIYPLNE------LKKREVKCEKDKVFLVNLASEKGEKITFKATGNNG 115

Human   807 SYWV 810
            |.||
  Fly   116 SIWV 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NDUFAF6NP_689629.2 SQS_PSY 65..311 CDD:425717
sicilyNP_572765.1 SQS_PSY 62..311 CDD:425717 14/64 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.