DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VPS37A and Vsp37A

DIOPT Version :10

Sequence 1:NP_689628.2 Gene:VPS37A / 137492 HGNCID:24928 Length:397 Species:Homo sapiens
Sequence 2:NP_525034.2 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster


Alignment Length:194 Identity:44/194 - (22%)
Similarity:88/194 - (45%) Gaps:8/194 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   191 PAAPSFGVLSNLPLPIPTVDASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQ 255
            |..|....|::.....|..|:|....|..      ...|..|.|..||:.:|..::...| ..|.
  Fly     2 PTTPQDLALAHSLAQRPPTDSSEAKEQEA------GESDNLPNLCTLSLDELKQLDRDPE-FFED 59

Human   256 FLTLPQLKQIITDK-DDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTFEKKMQRQH 319
            |:....:.|.:.:: |.::..:|.::|:|......|...::.:.|.:..|..:....::..::..
  Fly    60 FIEEMSVVQYLNEELDSMMDQVEIISRENECKGIHLVELKRRLSDDFTALKNLGEKCDRLNKKYF 124

Human   320 ELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKL 383
            :.|:..:...::..|::||..|:.:.|...|.||.||.::..||:::...:.|...|:||||:|
  Fly   125 KKSDEYAPQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNTYQWSKKISTERKAKEERL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VPS37ANP_689628.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
UEV_TSG101-like <70..131 CDD:467408
Mod_r 235..380 CDD:462117 30/145 (21%)
Vsp37ANP_525034.2 Mod_r 42..185 CDD:462117 30/143 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.