DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Emb and DIP-eta

DIOPT Version :9

Sequence 1:NP_034460.3 Gene:Emb / 13723 MGIID:95321 Length:330 Species:Mus musculus
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:271 Identity:61/271 - (22%)
Similarity:104/271 - (38%) Gaps:59/271 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    76 NVILEKPSHVELKCVYTATKDLNLMNVTWKKDD-EPLE-TTGDFNTTKMGNTLTSQYRFIVFNSK 138
            ::::.:.|:|.|||..|.:.:   ..:||:::. .|:| .||:...:..|..|      ::.|.:
  Fly   155 DMVVREGSNVTLKCAATGSPE---PTITWRRESGVPIELATGEEVMSIEGTDL------VIPNVR 210

Mouse   139 Q--LGKYSCVFG-----EKELRGTFNIHVPKAHGKKKSLIAYV-GDSTVLKCVCQDCLPLNWTWY 195
            :  :|.|.|:..     ....|.|..:|.|.....:..||..| |....|.|. .:..|.:..::
  Fly   211 RHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCE-SEAYPKSINYW 274

Mouse   196 MGNETAQVPIDAHSNEKYIIN----GSHANETRLKIKHLLEEDGGSYWCRATFQLGESEEQNELV 256
            .......||    ...||..|    |.:.|..||.|..|.:.:.|||.|.|...||:::...:| 
  Fly   275 TRERGEIVP----PGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKL- 334

Mouse   257 VLSFLVP------LKPFLAILAEVILLVAIILLCEVYTHKKKNDPDAGKEFEQIEQLKSDDSNGI 315
               :.:|      ::.|.|                  .||.|.   ..|..|.....::.:.:|.
  Fly   335 ---YRIPPNAVNYVENFEA------------------RHKGKK---RTKSSESHHPARAQEHSGE 375

Mouse   316 ENNVPRYRKTD 326
            :...|..||.|
  Fly   376 DMENPGKRKAD 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EmbNP_034460.3 Ig 85..146 CDD:143165 16/64 (25%)
IG_like 168..257 CDD:214653 26/93 (28%)
Ig 179..250 CDD:143165 21/74 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..330 7/34 (21%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845
IG_like 51..137 CDD:214653
IG_like 153..237 CDD:214653 20/90 (22%)
Ig 161..224 CDD:299845 18/71 (25%)
IG_like 252..335 CDD:214653 24/91 (26%)
Ig 258..333 CDD:143165 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.