DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elk4 and pnt

DIOPT Version :10

Sequence 1:NP_031949.2 Gene:Elk4 / 13714 MGIID:102853 Length:430 Species:Mus musculus
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster


Alignment Length:81 Identity:50/81 - (61%)
Similarity:60/81 - (74%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 ITLWQFLLQLLQEPQNEHMICWTSNNGEFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVK 69
            |.||||||:||.:...:..|.||.:..||||...:||||.||||||||.|||:||||.|||||.|
  Fly   610 IQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDK 674

Mouse    70 NIIKKVNGQKFVYKFV 85
            |||.|..|:::||:||
  Fly   675 NIIHKTAGKRYVYRFV 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elk4NP_031949.2 ETS 17..88 CDD:197710 41/69 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..138
PHA03247 <170..349 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..325
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 50/81 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.