DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elk1 and pnt

DIOPT Version :10

Sequence 1:NP_031948.4 Gene:Elk1 / 13712 MGIID:101833 Length:429 Species:Mus musculus
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster


Alignment Length:82 Identity:52/82 - (63%)
Similarity:64/82 - (78%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYD 69
            :.||||||:||.::.....||||. ||.||||.|.:||||.||:||||..|||:||||.||||||
  Fly   610 IQLWQFLLELLLDKTCQSFISWTG-DGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYD 673

Mouse    70 KNIIRKVSGQKFVYKFV 86
            ||||.|.:|:::||:||
  Fly   674 KNIIHKTAGKRYVYRFV 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elk1NP_031948.4 ETS 4..89 CDD:197710 52/82 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..146
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..204
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..253
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..354
Sufficient for interaction with MAD2L2. /evidence=ECO:0000250|UniProtKB:P19419 350..400
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 52/82 (63%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.