DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elk1 and pnt

DIOPT Version :9

Sequence 1:NP_031948.4 Gene:Elk1 / 13712 MGIID:101833 Length:429 Species:Mus musculus
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster


Alignment Length:82 Identity:52/82 - (63%)
Similarity:64/82 - (78%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYD 69
            :.||||||:||.::.....||||. ||.||||.|.:||||.||:||||..|||:||||.||||||
  Fly   610 IQLWQFLLELLLDKTCQSFISWTG-DGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYD 673

Mouse    70 KNIIRKVSGQKFVYKFV 86
            ||||.|.:|:::||:||
  Fly   674 KNIIHKTAGKRYVYRFV 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elk1NP_031948.4 ETS 4..89 CDD:197710 52/82 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..146
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..204
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..253
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..354
Sufficient for interaction with MAD2L2. /evidence=ECO:0000250|UniProtKB:P19419 350..400
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 52/82 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.