Sequence 1: | NP_001073982.3 | Gene: | CPN2 / 1370 | HGNCID: | 2313 | Length: | 545 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262995.1 | Gene: | Tl / 43222 | FlyBaseID: | FBgn0262473 | Length: | 1117 | Species: | Drosophila melanogaster |
Alignment Length: | 468 | Identity: | 127/468 - (27%) |
---|---|---|---|
Similarity: | 207/468 - (44%) | Gaps: | 69/468 - (14%) |
- Green bases have known domain annotations that are detailed below.
Human 40 LATVPLDIPPYTKNIIFVE--TSFTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDL 102
Human 103 EVTGSSFLNLSTNIFSNLTSLGKLTLNFNMLEALPEGLFQHLAALESLHLQGNQLQALPRRLFQP 167
Human 168 LTHLKTLNLAQNL--LAQLPEELFHPLTSLQTLKLSNNALSGLPQGVFGKLGSLQELFLDSNNIS 230
Human 231 ELPPQVFSQLFCLERLWLQRNAITHLPLSIFASLGNLTFLSLQWNMLRVLPAGLFAHTPCLVGLS 295
Human 296 LTHNQLETVAEGTFAHLSNLRSLMLSYNAI--------------THLPAGIFRDLEELVKLYLGS 346
Human 347 NNLTALH-------------PALFQNLSKL---ELLSLSKNQL-----------TTLPEGIF--- 381
Human 382 DTNYNLFNLALHGNPWQCDCHLAYLFNWLQ-----QY-------TDRLLNIQTYCAGPAYLKGQV 434
Human 435 VPALNEKQLVCPV 447 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CPN2 | NP_001073982.3 | LRRNT | 21..53 | CDD:214470 | 2/12 (17%) |
leucine-rich repeat | 30..53 | CDD:275380 | 2/12 (17%) | ||
leucine-rich repeat | 75..98 | CDD:275380 | 6/22 (27%) | ||
LRR 1 | 98..119 | 5/20 (25%) | |||
leucine-rich repeat | 99..122 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 121..181 | CDD:290566 | 19/61 (31%) | ||
LRR 2 | 122..143 | 6/20 (30%) | |||
leucine-rich repeat | 123..146 | CDD:275380 | 7/22 (32%) | ||
LRR 3 | 146..167 | 6/20 (30%) | |||
leucine-rich repeat | 147..170 | CDD:275380 | 6/22 (27%) | ||
LRR_RI | 149..>356 | CDD:238064 | 66/235 (28%) | ||
LRR_8 | 169..229 | CDD:290566 | 20/61 (33%) | ||
LRR 4 | 170..191 | 10/22 (45%) | |||
leucine-rich repeat | 171..194 | CDD:275380 | 9/24 (38%) | ||
LRR 5 | 194..215 | 8/20 (40%) | |||
leucine-rich repeat | 195..218 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 218..277 | CDD:290566 | 21/58 (36%) | ||
LRR 6 | 218..239 | 4/20 (20%) | |||
leucine-rich repeat | 219..242 | CDD:275380 | 4/22 (18%) | ||
LRR 7 | 242..263 | 10/20 (50%) | |||
leucine-rich repeat | 243..266 | CDD:275380 | 11/22 (50%) | ||
LRR 8 | 266..287 | 8/20 (40%) | |||
leucine-rich repeat | 267..290 | CDD:275380 | 7/22 (32%) | ||
LRR 9 | 290..311 | 7/20 (35%) | |||
leucine-rich repeat | 291..314 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 294..349 | CDD:290566 | 17/68 (25%) | ||
LRR 10 | 314..335 | 8/34 (24%) | |||
leucine-rich repeat | 315..338 | CDD:275380 | 8/36 (22%) | ||
LRR 11 | 338..359 | 4/33 (12%) | |||
leucine-rich repeat | 339..359 | CDD:275380 | 4/32 (13%) | ||
LRR 12 | 362..383 | 9/37 (24%) | |||
leucine-rich repeat | 363..382 | CDD:275380 | 9/35 (26%) | ||
leucine-rich repeat | 387..399 | CDD:275378 | 4/11 (36%) | ||
LRRCT | 395..446 | CDD:214507 | 17/62 (27%) | ||
Tl | NP_001262995.1 | LRR_8 | 174..233 | CDD:290566 | 13/58 (22%) |
leucine-rich repeat | 176..198 | CDD:275380 | 2/21 (10%) | ||
leucine-rich repeat | 199..222 | CDD:275380 | 6/22 (27%) | ||
LRR_RI | 216..542 | CDD:238064 | 93/329 (28%) | ||
LRR_8 | 221..281 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 223..270 | CDD:275380 | 14/46 (30%) | ||
leucine-rich repeat | 271..294 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 295..320 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 321..343 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 342..402 | CDD:290566 | 21/59 (36%) | ||
leucine-rich repeat | 344..367 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 368..391 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 390..450 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 392..415 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 416..439 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 440..474 | CDD:275380 | 8/36 (22%) | ||
leucine-rich repeat | 475..498 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 477..534 | CDD:290566 | 11/56 (20%) | ||
leucine-rich repeat | 499..520 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 523..552 | CDD:275380 | 6/28 (21%) | ||
LRRCT | 561..619 | CDD:214507 | 17/62 (27%) | ||
LRRNT | 631..667 | CDD:214470 | |||
leucine-rich repeat | 664..693 | CDD:275380 | |||
LRR_8 | 669..726 | CDD:290566 | |||
leucine-rich repeat | 694..715 | CDD:275380 | |||
leucine-rich repeat | 716..737 | CDD:275380 | |||
LRRCT | 751..800 | CDD:214507 | |||
TIR | 858..996 | CDD:214587 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm8435 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |