Sequence 1: | NP_001073982.3 | Gene: | CPN2 / 1370 | HGNCID: | 2313 | Length: | 545 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246765.1 | Gene: | Toll-6 / 39663 | FlyBaseID: | FBgn0036494 | Length: | 1514 | Species: | Drosophila melanogaster |
Alignment Length: | 478 | Identity: | 131/478 - (27%) |
---|---|---|---|
Similarity: | 202/478 - (42%) | Gaps: | 121/478 - (25%) |
- Green bases have known domain annotations that are detailed below.
Human 33 VFCSDEELATVPLDIPPYTKNIIFVETSFTTLETRAFGSNPNLTKVVFLNTQLC----------- 86
Human 87 ----------------------QFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNLTSLGKLTLN 129
Human 130 FNMLEALPEGLFQHLAA-----------------------------LESLHLQGNQLQALPRRLF 165
Human 166 QPLTHLKTLNLAQNLLAQLPEELFHPLTSLQTLKLSNNALSGLPQGVFGKLGS-LQELFLDSNNI 229
Human 230 SELPPQVFSQLFCLERLWLQRNAITH--LPLSIFASLGNLTFLSLQWNMLRVLPAGLFAHTPCLV 292
Human 293 GLSLTHNQLETVAEGTFAHLSNLRSLMLSYNAITHLPAGIFRDLEELVKLYLGSNNLTALHPALF 357
Human 358 QNLSKLELLSLSKNQLTTLP-----------------------EGIFDTNYNLFNLALHGNPWQC 399
Human 400 DCHLAYLFNWLQQYTDR-LLNIQ 421 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CPN2 | NP_001073982.3 | LRRNT | 21..53 | CDD:214470 | 4/19 (21%) |
leucine-rich repeat | 30..53 | CDD:275380 | 4/19 (21%) | ||
leucine-rich repeat | 75..98 | CDD:275380 | 7/55 (13%) | ||
LRR 1 | 98..119 | 8/20 (40%) | |||
leucine-rich repeat | 99..122 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 121..181 | CDD:290566 | 17/88 (19%) | ||
LRR 2 | 122..143 | 6/20 (30%) | |||
leucine-rich repeat | 123..146 | CDD:275380 | 6/22 (27%) | ||
LRR 3 | 146..167 | 7/49 (14%) | |||
leucine-rich repeat | 147..170 | CDD:275380 | 8/22 (36%) | ||
LRR_RI | 149..>356 | CDD:238064 | 74/209 (35%) | ||
LRR_8 | 169..229 | CDD:290566 | 17/60 (28%) | ||
LRR 4 | 170..191 | 3/20 (15%) | |||
leucine-rich repeat | 171..194 | CDD:275380 | 4/22 (18%) | ||
LRR 5 | 194..215 | 9/20 (45%) | |||
leucine-rich repeat | 195..218 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 218..277 | CDD:290566 | 24/61 (39%) | ||
LRR 6 | 218..239 | 10/21 (48%) | |||
leucine-rich repeat | 219..242 | CDD:275380 | 12/22 (55%) | ||
LRR 7 | 242..263 | 7/22 (32%) | |||
leucine-rich repeat | 243..266 | CDD:275380 | 8/24 (33%) | ||
LRR 8 | 266..287 | 7/20 (35%) | |||
leucine-rich repeat | 267..290 | CDD:275380 | 7/22 (32%) | ||
LRR 9 | 290..311 | 11/20 (55%) | |||
leucine-rich repeat | 291..314 | CDD:275380 | 12/22 (55%) | ||
LRR_8 | 294..349 | CDD:290566 | 24/54 (44%) | ||
LRR 10 | 314..335 | 8/20 (40%) | |||
leucine-rich repeat | 315..338 | CDD:275380 | 8/22 (36%) | ||
LRR 11 | 338..359 | 8/20 (40%) | |||
leucine-rich repeat | 339..359 | CDD:275380 | 8/19 (42%) | ||
LRR 12 | 362..383 | 9/43 (21%) | |||
leucine-rich repeat | 363..382 | CDD:275380 | 8/41 (20%) | ||
leucine-rich repeat | 387..399 | CDD:275378 | 5/11 (45%) | ||
LRRCT | 395..446 | CDD:214507 | 9/28 (32%) | ||
Toll-6 | NP_001246765.1 | leucine-rich repeat | 148..171 | CDD:275380 | 3/22 (14%) |
LRR_8 | 171..236 | CDD:290566 | 15/64 (23%) | ||
leucine-rich repeat | 172..201 | CDD:275380 | 3/28 (11%) | ||
leucine-rich repeat | 202..278 | CDD:275380 | 14/75 (19%) | ||
leucine-rich repeat | 229..249 | CDD:275380 | 5/19 (26%) | ||
LRR_RI | 278..468 | CDD:238064 | 68/189 (36%) | ||
leucine-rich repeat | 279..302 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 301..386 | CDD:290566 | 29/84 (35%) | ||
leucine-rich repeat | 303..326 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 327..350 | CDD:275380 | 9/22 (41%) | ||
LRR | 350..729 | CDD:227223 | 81/231 (35%) | ||
leucine-rich repeat | 352..375 | CDD:275380 | 12/22 (55%) | ||
leucine-rich repeat | 376..401 | CDD:275380 | 8/24 (33%) | ||
LRR_RI | <401..626 | CDD:238064 | 61/180 (34%) | ||
leucine-rich repeat | 402..425 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 426..449 | CDD:275380 | 12/22 (55%) | ||
leucine-rich repeat | 450..473 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 474..497 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 498..518 | CDD:275380 | 8/19 (42%) | ||
leucine-rich repeat | 521..544 | CDD:275380 | 1/22 (5%) | ||
leucine-rich repeat | 545..566 | CDD:275380 | 10/30 (33%) | ||
leucine-rich repeat | 569..592 | CDD:275380 | 1/2 (50%) | ||
leucine-rich repeat | 593..615 | CDD:275380 | |||
leucine-rich repeat | 616..637 | CDD:275380 | |||
leucine-rich repeat | 638..662 | CDD:275380 | |||
leucine-rich repeat | 663..684 | CDD:275380 | |||
leucine-rich repeat | 685..708 | CDD:275380 | |||
leucine-rich repeat | 709..728 | CDD:275380 | |||
LRR_8 | 883..943 | CDD:290566 | |||
leucine-rich repeat | 885..908 | CDD:275380 | |||
leucine-rich repeat | 909..932 | CDD:275380 | |||
LRR_8 | 932..990 | CDD:290566 | |||
leucine-rich repeat | 933..956 | CDD:275380 | |||
TIR | 1114..1247 | CDD:214587 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm8435 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |