DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPN2 and Toll-6

DIOPT Version :9

Sequence 1:NP_001073982.3 Gene:CPN2 / 1370 HGNCID:2313 Length:545 Species:Homo sapiens
Sequence 2:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster


Alignment Length:478 Identity:131/478 - (27%)
Similarity:202/478 - (42%) Gaps:121/478 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    33 VFCSDEELATVPLDIPPYTKNIIFVETSFTTLETRAFGSNPNLTKVVFLNTQLC----------- 86
            :.|:||.:|.                   :.||.::|.   :|.::..|:.|.|           
  Fly   125 ILCNDEIMAK-------------------SRLEAQSFA---HLVRLQQLSIQYCKLGRLGRQVLD 167

Human    87 ----------------------QFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNLTSLGKLTLN 129
                                  :...|||....|||.|:::.::..:|..|||..|:.|..|.::
  Fly   168 GLEQLRNLTLRTHNILWPALNFEIEADAFSVTRRLERLDLSSNNIWSLPDNIFCTLSELSALNMS 232

Human   130 FNMLEALPEGLFQHLAA-----------------------------LESLHLQGNQLQALPRRLF 165
            .|.|:.:.|..|:..:.                             ||.|.:..|....||...|
  Fly   233 ENRLQDVNELGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGF 297

Human   166 QPLTHLKTLNLAQNLLAQLPEELFHPLTSLQTLKLSNNALSGLPQGVFGKLGS-LQELFLDSNNI 229
            ..|..|:.|::..|.::.:.::....|.:||.|.||:|.:..||..:|.:... :||::|.:|:|
  Fly   298 GTLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSI 362

Human   230 SELPPQVFSQLFCLERLWLQRNAITH--LPLSIFASLGNLTFLSLQWNMLRVLPAGLFAHTPCLV 292
            |.|.||:||.|..|:.|.|..|.||.  :..:.|..|..|..|:|..|.|..|...:|:....|.
  Fly   363 SVLNPQLFSNLDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQ 427

Human   293 GLSLTHNQLETVAEGTFAHLSNLRSLMLSYNAITHLPAGIFRDLEELVKLYLGSNNLTALHPALF 357
            .|:|.|||||.:|..|||.::||.:|:||:|.:.:|.|.....|..|..|.|.:|.|..:||..|
  Fly   428 ILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAF 492

Human   358 QNLSKLELLSLSKNQLTTLP-----------------------EGIFDTNYNLFNLALHGNPWQC 399
            :|.|.|:.|:|:.|||.|:|                       :..|....||:.|.|.||    
  Fly   493 RNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGN---- 553

Human   400 DCHLAYLFNWLQQYTDR-LLNIQ 421
                 ||.| :..:|.| |.|:|
  Fly   554 -----YLEN-ITMHTFRDLPNLQ 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPN2NP_001073982.3 LRRNT 21..53 CDD:214470 4/19 (21%)
leucine-rich repeat 30..53 CDD:275380 4/19 (21%)
leucine-rich repeat 75..98 CDD:275380 7/55 (13%)
LRR 1 98..119 8/20 (40%)
leucine-rich repeat 99..122 CDD:275380 8/22 (36%)
LRR_8 121..181 CDD:290566 17/88 (19%)
LRR 2 122..143 6/20 (30%)
leucine-rich repeat 123..146 CDD:275380 6/22 (27%)
LRR 3 146..167 7/49 (14%)
leucine-rich repeat 147..170 CDD:275380 8/22 (36%)
LRR_RI 149..>356 CDD:238064 74/209 (35%)
LRR_8 169..229 CDD:290566 17/60 (28%)
LRR 4 170..191 3/20 (15%)
leucine-rich repeat 171..194 CDD:275380 4/22 (18%)
LRR 5 194..215 9/20 (45%)
leucine-rich repeat 195..218 CDD:275380 9/22 (41%)
LRR_8 218..277 CDD:290566 24/61 (39%)
LRR 6 218..239 10/21 (48%)
leucine-rich repeat 219..242 CDD:275380 12/22 (55%)
LRR 7 242..263 7/22 (32%)
leucine-rich repeat 243..266 CDD:275380 8/24 (33%)
LRR 8 266..287 7/20 (35%)
leucine-rich repeat 267..290 CDD:275380 7/22 (32%)
LRR 9 290..311 11/20 (55%)
leucine-rich repeat 291..314 CDD:275380 12/22 (55%)
LRR_8 294..349 CDD:290566 24/54 (44%)
LRR 10 314..335 8/20 (40%)
leucine-rich repeat 315..338 CDD:275380 8/22 (36%)
LRR 11 338..359 8/20 (40%)
leucine-rich repeat 339..359 CDD:275380 8/19 (42%)
LRR 12 362..383 9/43 (21%)
leucine-rich repeat 363..382 CDD:275380 8/41 (20%)
leucine-rich repeat 387..399 CDD:275378 5/11 (45%)
LRRCT 395..446 CDD:214507 9/28 (32%)
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380 3/22 (14%)
LRR_8 171..236 CDD:290566 15/64 (23%)
leucine-rich repeat 172..201 CDD:275380 3/28 (11%)
leucine-rich repeat 202..278 CDD:275380 14/75 (19%)
leucine-rich repeat 229..249 CDD:275380 5/19 (26%)
LRR_RI 278..468 CDD:238064 68/189 (36%)
leucine-rich repeat 279..302 CDD:275380 8/22 (36%)
LRR_8 301..386 CDD:290566 29/84 (35%)
leucine-rich repeat 303..326 CDD:275380 4/22 (18%)
leucine-rich repeat 327..350 CDD:275380 9/22 (41%)
LRR 350..729 CDD:227223 81/231 (35%)
leucine-rich repeat 352..375 CDD:275380 12/22 (55%)
leucine-rich repeat 376..401 CDD:275380 8/24 (33%)
LRR_RI <401..626 CDD:238064 61/180 (34%)
leucine-rich repeat 402..425 CDD:275380 7/22 (32%)
leucine-rich repeat 426..449 CDD:275380 12/22 (55%)
leucine-rich repeat 450..473 CDD:275380 8/22 (36%)
leucine-rich repeat 474..497 CDD:275380 9/22 (41%)
leucine-rich repeat 498..518 CDD:275380 8/19 (42%)
leucine-rich repeat 521..544 CDD:275380 1/22 (5%)
leucine-rich repeat 545..566 CDD:275380 10/30 (33%)
leucine-rich repeat 569..592 CDD:275380 1/2 (50%)
leucine-rich repeat 593..615 CDD:275380
leucine-rich repeat 616..637 CDD:275380
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8435
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.