DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPN2 and CG42709

DIOPT Version :9

Sequence 1:NP_001073982.3 Gene:CPN2 / 1370 HGNCID:2313 Length:545 Species:Homo sapiens
Sequence 2:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:216 Identity:60/216 - (27%)
Similarity:93/216 - (43%) Gaps:36/216 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    22 CPMGCDC-----FVQEVFCSDEELATVPLDIP------PYTKNII-------FVETS-------- 60
            ||..|.|     |||   |::..|..||||:|      ..:.|:|       |...|        
  Fly    93 CPRNCLCLEDFKFVQ---CANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLN 154

Human    61 ---FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNLTS 122
               .::::...|..:..|.::...|.:|.:..||.|.....|..|:::.::........|.|...
  Fly   155 HNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPD 219

Human   123 LGKLT-LNFNMLEALPEGLFQHLAALESLHLQGNQL-QALPRRLFQPLTHLKTLNLAQNLLAQLP 185
            |.:.: :|.:..| |||..||:::.||.|.|..|.. |.:..:.|.|||.:..|.|.: |..|..
  Fly   220 LVEFSCVNCSWTE-LPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPE-LEQQNI 282

Human   186 EELFHPLTSLQTLKLSNNALS 206
            |||...|||:.|:...|..:|
  Fly   283 EELCSLLTSIDTISFLNYDIS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPN2NP_001073982.3 LRRNT 21..53 CDD:214470 14/41 (34%)
leucine-rich repeat 30..53 CDD:275380 9/28 (32%)
leucine-rich repeat 75..98 CDD:275380 6/22 (27%)
LRR 1 98..119 3/20 (15%)
leucine-rich repeat 99..122 CDD:275380 4/22 (18%)
LRR_8 121..181 CDD:290566 20/61 (33%)
LRR 2 122..143 7/21 (33%)
leucine-rich repeat 123..146 CDD:275380 8/23 (35%)
LRR 3 146..167 7/21 (33%)
leucine-rich repeat 147..170 CDD:275380 9/23 (39%)
LRR_RI 149..>356 CDD:238064 21/59 (36%)
LRR_8 169..229 CDD:290566 14/38 (37%)
LRR 4 170..191 7/20 (35%)
leucine-rich repeat 171..194 CDD:275380 8/22 (36%)
LRR 5 194..215 4/13 (31%)
leucine-rich repeat 195..218 CDD:275380 3/12 (25%)
LRR_8 218..277 CDD:290566
LRR 6 218..239
leucine-rich repeat 219..242 CDD:275380
LRR 7 242..263
leucine-rich repeat 243..266 CDD:275380
LRR 8 266..287
leucine-rich repeat 267..290 CDD:275380
LRR 9 290..311
leucine-rich repeat 291..314 CDD:275380
LRR_8 294..349 CDD:290566
LRR 10 314..335
leucine-rich repeat 315..338 CDD:275380
LRR 11 338..359
leucine-rich repeat 339..359 CDD:275380
LRR 12 362..383
leucine-rich repeat 363..382 CDD:275380
leucine-rich repeat 387..399 CDD:275378
LRRCT 395..446 CDD:214507
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 7/55 (13%)
leucine-rich repeat 128..147 CDD:275380 3/18 (17%)
leucine-rich repeat 148..171 CDD:275380 1/22 (5%)
LRR_RI <150..225 CDD:238064 12/74 (16%)
LRR_8 171..254 CDD:290566 23/83 (28%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 4/22 (18%)
leucine-rich repeat 220..243 CDD:275380 8/23 (35%)
leucine-rich repeat 244..268 CDD:275380 9/23 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.