DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eif4e and eIF4EHP

DIOPT Version :9

Sequence 1:XP_006501056.1 Gene:Eif4e / 13684 MGIID:95305 Length:230 Species:Mus musculus
Sequence 2:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster


Alignment Length:206 Identity:58/206 - (28%)
Similarity:97/206 - (47%) Gaps:29/206 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 VVRSDRSKMATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKT-- 68
            :|.||.|.:    .......|.||.|....|:.             ||:.:.|||.:.:..:.  
  Fly    19 IVDSDDSDV----DNQIDVDNLPPLEVGPGENR-------------LQHTYCLWFSRKETQRAAA 66

Mouse    69 -WQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNK 132
             :..:|.::.:..:|:.:|:||:|:...:.|.|..:..|||.||.|||||..|.:||:|||.|  
  Fly    67 DYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRL-- 129

Mouse   133 QQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYK 197
              |::.:||.|....:.::||.| ...|::||.|:..:.....|.:   .|.:|..:..|...:.
  Fly   130 --RKNKVDRAWENVCMAMLGEQF-LVGDEICGVVLQTKYPNPSIQV---ACSSRPIICIIYTRFV 188

Mouse   198 ERLGLPPKIVI 208
            .:.| ..||:|
  Fly   189 VQFG-KCKIII 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eif4eXP_006501056.1 IF4E 51..210 CDD:366742 49/161 (30%)
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 40/126 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.