Sequence 1: | XP_006501056.1 | Gene: | Eif4e / 13684 | MGIID: | 95305 | Length: | 230 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163710.1 | Gene: | eIF4EHP / 326255 | FlyBaseID: | FBgn0053100 | Length: | 248 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 58/206 - (28%) |
---|---|---|---|
Similarity: | 97/206 - (47%) | Gaps: | 29/206 - (14%) |
- Green bases have known domain annotations that are detailed below.
Mouse 6 VVRSDRSKMATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKT-- 68
Mouse 69 -WQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNK 132
Mouse 133 QQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYK 197
Mouse 198 ERLGLPPKIVI 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Eif4e | XP_006501056.1 | IF4E | 51..210 | CDD:366742 | 49/161 (30%) |
eIF4EHP | NP_001163710.1 | IF4E | 50..>172 | CDD:279921 | 40/126 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830796 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5053 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1394271at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.750 |