DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPM and CG4408

DIOPT Version :9

Sequence 1:NP_001005502.1 Gene:CPM / 1368 HGNCID:2311 Length:443 Species:Homo sapiens
Sequence 2:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster


Alignment Length:277 Identity:66/277 - (23%)
Similarity:115/277 - (41%) Gaps:57/277 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    22 YHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYV-ANMHGD 85
            ||..|.:.|:||.:|:.:..|. |..:|.|.:||.:..:.:. |..|:|..:    :| :.:|..
  Fly   179 YHPLESINAWLKKLAETHPEVL-LVELGVSAQGRPILGVQIA-FDNENRTTV----FVESGIHAR 237

Human    86 ETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENY--- 147
            |.:......::||.||.|  ||..:..|..|.|.:|.|::||||::...|.|..:...|..:   
  Fly   238 EWIAPATATYIIDQLVNS--KDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRALFGIC 300

Human   148 NQYDLNRNFPDAFEYNNVSRQP--------------ETVAVMKWL-------KTETFVLSANLHG 191
            ...|||||||..:.....|..|              ||..:::::       :..||:   :||.
  Fly   301 RGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFI---SLHS 362

Human   192 GALVASYPFDNGVQATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGDECKNKMNFPNGVTNGY 256
            .:.:..:|:.:..:.....:  .||   |:.:..|:.....:..:.|.......:          
  Fly   363 YSQMIMFPYGHSAERVDNYH--DLT---DIGKLAANKIKDVSGRIYKSGSIYETI---------- 412

Human   257 SWYPLQGGMQDYNYIWA 273
              ||..||.:|    ||
  Fly   413 --YPSSGGSKD----WA 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPMNP_001005502.1 M14_CPM 18..310 CDD:199848 66/277 (24%)
Peptidase_M14NE-CP-C_like 314..394 CDD:200604
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 66/277 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4288
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.