DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPM and svr

DIOPT Version :9

Sequence 1:NP_001005502.1 Gene:CPM / 1368 HGNCID:2311 Length:443 Species:Homo sapiens
Sequence 2:NP_001284744.1 Gene:svr / 30998 FlyBaseID:FBgn0004648 Length:1439 Species:Drosophila melanogaster


Alignment Length:412 Identity:173/412 - (41%)
Similarity:249/412 - (60%) Gaps:33/412 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    21 NYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGD 85
            :|..||.:|.....:.:.|.:...:|.:|:|::||||..|.:.|..:...:..|..||:||||||
  Fly    39 HYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQISRNTRSRNLLTPPVKYIANMHGD 103

Human    86 ETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDC-----YYSIGRE 145
            |||||:||:::..||:.:..:..::..|:|||.|:::|:|||||:...::.:|     |  :||.
  Fly   104 ETVGRQLLVYMAQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNY--VGRG 166

Human   146 NYNQYDLNRNFPDAFEYNNV------SRQPETVAVMKWLKTETFVLSANLHGGALVASYPFDNGV 204
            |....||||:|||..|.::|      ||||||.|::.|:.::.||||||.||||:|||||:||.:
  Fly   167 NAANIDLNRDFPDRLEQSHVHQLRAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSL 231

Human   205 QATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGDECKNKMNFPNGVTNGYSWYPLQGGMQDYN 269
             |.......||||||.||:.|||||:..:|.|:||:.|.:  :|..|:|||..||.|.|||||:|
  Fly   232 -AHNECCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNCND--SFSGGITNGAHWYELSGGMQDFN 293

Human   270 YIWAQCFEITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKGQVFDQNGNPL--PNVIV 332
            |.::.|||:|:||||||||....||..|..|||||::.::|.|:|:||.|.|.:|.|:  .||.|
  Fly   294 YAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVTDASGFPIADANVYV 358

Human   333 EVQDRKHICPYRTNKYGEYYLLLLPGSYIINVTVPGHD---PHITKVIIPEKSQNFSALKKDILL 394
            ...:.|   |.||:|.|||:.||.||.|.::.:..|:.   |...:|    .:.|..||:.|..|
  Fly   359 AGLEEK---PMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRV----TNDNQEALRLDFKL 416

Human   395 P-----FQGQLDSIPVSNPSCP 411
            .     |.|....:.|.....|
  Fly   417 APVETNFDGNFRKVKVERSEPP 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPMNP_001005502.1 M14_CPM 18..310 CDD:199848 136/299 (45%)
Peptidase_M14NE-CP-C_like 314..394 CDD:200604 30/84 (36%)
svrNP_001284744.1 M14_CPD_I 40..334 CDD:199850 136/298 (46%)
Peptidase_M14NE-CP-C_like 338..416 CDD:200604 30/84 (36%)
M14_CP_N-E_like 456..759 CDD:199842
Peptidase_M14NE-CP-C_like 763..839 CDD:200604
CarbopepD_reg_2 1125..1202 CDD:290434
CarboxypepD_reg 1223..1301 CDD:290350
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4288
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101221at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3496
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.