DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eif1a and eIF1A

DIOPT Version :9

Sequence 1:NP_001361583.1 Gene:Eif1a / 13664 MGIID:95298 Length:254 Species:Mus musculus
Sequence 2:NP_001287386.1 Gene:eIF1A / 44260 FlyBaseID:FBgn0026250 Length:148 Species:Drosophila melanogaster


Alignment Length:148 Identity:113/148 - (76%)
Similarity:126/148 - (85%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse   111 MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVRRLCHIRGKL 175
            ||||||||||||||||||||.|||||:||||.||||||.||||||||||||||||:|||||||||
  Fly     1 MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKL 65

Mouse   176 RKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTF-GPGDDDEI 239
            |||||||..||||:|||||||:||||||||..||||:||.|||.||..:||||.|| ..|.|::|
  Fly    66 RKKVWINQGDIILVGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINETVTFVEDGFDEDI 130

Mouse   240 QF-DDIG--DDDEDIDDI 254
            :| |:|.  ||.:.:|:|
  Fly   131 EFGDEISSEDDADSVDNI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eif1aNP_001361583.1 PTZ00329 111..241 CDD:185558 106/130 (82%)
eIF1ANP_001287386.1 PTZ00329 1..147 CDD:185558 111/145 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845665
Domainoid 1 1.000 119 1.000 Domainoid score I5769
eggNOG 1 0.900 - - E1_COG0361
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3451
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54096
OrthoDB 1 1.010 - - D1426335at2759
OrthoFinder 1 1.000 - - FOG0000631
OrthoInspector 1 1.000 - - otm43508
orthoMCL 1 0.900 - - OOG6_100738
Panther 1 1.100 - - O PTHR21668
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R590
SonicParanoid 1 1.000 - - X376
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.