DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egr4 and btd

DIOPT Version :9

Sequence 1:NP_065621.1 Gene:Egr4 / 13656 MGIID:99252 Length:478 Species:Mus musculus
Sequence 2:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster


Alignment Length:357 Identity:98/357 - (27%)
Similarity:134/357 - (37%) Gaps:100/357 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse   181 LRAPPASPALDAAASAFKGPY---APWEL----LSAGVPGNCGSQGSFQTTPEARFSAVGTKVED 238
            |.|||:.....:.:|:...|.   .|.:|    ..|...|......|.|:.|.:           
  Fly    99 LSAPPSLSGSSSGSSSGSSPLYGKPPMKLELPYPQASSTGTASPNSSIQSAPSS----------- 152

Mouse   239 LLSISCPAELPGPA---ARLYQAGAYDTFSLAP------GDLGEGTEGLPALLTPPGGEGGSGGE 294
             .|:| |:..|.||   |.:..:.:..|.:|||      |.|.    |.|...:|    ..|...
  Fly   153 -ASVS-PSIFPSPAQSFASISASPSTPTTTLAPPTTAAAGALA----GSPTSSSP----SSSAAS 207

Mouse   295 GGEFLAAPPAQLSPLGLRGAATADFS--------KPLVADLP--------GGSGVAAPSSPA--- 340
            .....||..|..:.||....|:|.:.        .|..:..|        .|:.|...||.|   
  Fly   208 AAAAAAAAAAAAADLGAAAVASAAYGWNTAYSGLGPARSQFPYAQYASDYYGNAVGMSSSAAWFS 272

Mouse   341 -----------ASFPA------AKARRKGRRGGKCSARCFCPR---------PHV-------KAF 372
                       .|:|.      |...:..||    |.||.||.         |.|       |..
  Fly   273 HQERLYQPWSSQSYPGFNFDDIAFQTQLQRR----SVRCTCPNCTNEMSGLPPIVGPDERGRKQH 333

Mouse   373 ACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGR 437
            .|.:..|.|.:.::..|..|||.|||.:||.|..|.:.|||||.|..|.||||..:|:||.:|.:
  Fly   334 ICHIPGCERLYGKASHLKTHLRWHTGERPFLCLTCGKRFSRSDELQRHGRTHTNYRPYACPICSK 398

Mouse   438 RFARSDEKKRHSKVHLKQK-------ARAEER 462
            :|:|||...:|.|.|.|.|       |.|:|:
  Fly   399 KFSRSDHLSKHKKTHFKDKKSKKVLAAEAKEQ 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Egr4NP_065621.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..302 5/26 (19%)
zf-C2H2 372..396 CDD:278523 7/23 (30%)
C2H2 Zn finger 374..396 CDD:275368 7/21 (33%)
zf-H2C2_2 388..413 CDD:290200 12/24 (50%)
COG5048 400..>458 CDD:227381 28/64 (44%)
C2H2 Zn finger 404..424 CDD:275368 10/19 (53%)
zf-H2C2_2 416..441 CDD:290200 11/24 (46%)
C2H2 Zn finger 432..452 CDD:275368 8/19 (42%)
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 6/18 (33%)
zf-H2C2_2 349..374 CDD:290200 12/24 (50%)
C2H2 Zn finger 365..385 CDD:275368 10/19 (53%)
zf-H2C2_2 377..402 CDD:290200 11/24 (46%)
zf-C2H2 391..413 CDD:278523 9/21 (43%)
C2H2 Zn finger 393..413 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.