| Sequence 1: | NP_031939.1 | Gene: | Egr1 / 13653 | MGIID: | 95295 | Length: | 533 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_722922.1 | Gene: | odd / 33583 | FlyBaseID: | FBgn0002985 | Length: | 392 | Species: | Drosophila melanogaster |
| Alignment Length: | 221 | Identity: | 56/221 - (25%) |
|---|---|---|---|
| Similarity: | 83/221 - (37%) | Gaps: | 70/221 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 322 YPNRPSKTPPHERPYACPVES-------------------------------------------- 342
Mouse 343 -CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFA-- 404
Mouse 405 ----------------------RSDERKRHTKIHLRQKDKKADKSVVASPAASSLSSYPSPVATS 447
Mouse 448 YPSPATTSFPSPVPTSYSSPGSSTYP 473 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Egr1 | NP_031939.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..94 | ||
| DUF3446 | 132..207 | CDD:288757 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..237 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 316..336 | 5/13 (38%) | |||
| zf-C2H2 | 336..360 | CDD:278523 | 9/68 (13%) | ||
| C2H2 Zn finger | 338..360 | CDD:275368 | 8/66 (12%) | ||
| zf-H2C2_2 | 352..377 | CDD:290200 | 10/24 (42%) | ||
| COG5048 | 363..>421 | CDD:227381 | 23/81 (28%) | ||
| C2H2 Zn finger | 368..388 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 380..405 | CDD:290200 | 11/48 (23%) | ||
| C2H2 Zn finger | 396..416 | CDD:275368 | 7/43 (16%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 407..478 | 19/67 (28%) | |||
| DUF3432 | 426..520 | CDD:288743 | 16/48 (33%) | ||
| BES1_N | <441..478 | CDD:283367 | 12/33 (36%) | ||
| odd | NP_722922.1 | COG5048 | <203..334 | CDD:227381 | 33/130 (25%) |
| C2H2 Zn finger | 222..242 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 234..259 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 250..270 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 262..285 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 278..298 | CDD:275368 | 4/19 (21%) | ||
| zf-C2H2 | 304..326 | CDD:278523 | 5/21 (24%) | ||
| C2H2 Zn finger | 306..326 | CDD:275368 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.030 | |||||