DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efna3 and Ephrin

DIOPT Version :9

Sequence 1:NP_034238.1 Gene:Efna3 / 13638 MGIID:106644 Length:230 Species:Mus musculus
Sequence 2:NP_651927.1 Gene:Ephrin / 43799 FlyBaseID:FBgn0040324 Length:652 Species:Drosophila melanogaster


Alignment Length:218 Identity:53/218 - (24%)
Similarity:85/218 - (38%) Gaps:54/218 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 LLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVN--------DYLDIYC 63
            ||.|:.:...||..::     :......::||:||...|.:.....::||        |.:.|.|
  Fly   196 LLTLICMETVLLSTMS-----SCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIIC 255

Mouse    64 PHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSL-- 126
            |.|.........|:|::|.|:...|.||..:....|           .|...:|.|:...|::  
  Fly   256 PVYEPGTFENETEKYIIYNVSKVEYETCRITNADPR-----------VIAICDKPQKLMFFTITF 309

Mouse   127 --------GYEFHAGQEYYYISTPT-----HNLHWKCL--RMKVF--VCCA------STSHSGEK 168
                    |.||..|.:||:|||.:     ..:..:|.  .|||.  ||||      :|:.|..|
  Fly   310 RPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGGRCSTNNMKVVFKVCCAPEDNNKTTALSNSK 374

Mouse   169 PVPTLPQFTMGPNVKINVLEDFE 191
            .|.     ..|..:.:|:..:.|
  Fly   375 SVT-----DTGGAINVNIANNDE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Efna3NP_034238.1 Ephrin-A_Ectodomain 31..158 CDD:259896 37/153 (24%)
EphrinNP_651927.1 Ephrin_ectodomain 217..358 CDD:259861 37/151 (25%)
PigN <557..>622 CDD:282796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843264
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3858
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11304
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.