DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPA3 and CG4408

DIOPT Version :9

Sequence 1:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster


Alignment Length:424 Identity:132/424 - (31%)
Similarity:210/424 - (49%) Gaps:46/424 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    10 IATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNE-LDFW----YPG--ATHHVAANMMVD 67
            |.|.......|:|..::::|:...|:...:.:.|.:.:: ..|.    .||  .|..|....:.|
  Fly    70 IKTAADSVQARYDHTRIYQVELASEEHVRLFQALEQASDSCSFMGHARQPGQKLTIMVTGAKVAD 134

Human    68 F-----------RVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYNN 121
            |           ||.....||:   :|.|  :.|:...|.:.|   :||.|          :|:.
  Fly   135 FDDLVHSYNVTHRVLNYNFQAL---IDAN--YLEVAPEDTKPE---EFDWK----------RYHP 181

Human   122 WEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREWVSPAFC 186
            .|.|.||.:|:.:.:|| |..:::|.:.:..|:..::|...||.|..:|.:.|||||||::||..
  Fly   182 LESINAWLKKLAETHPE-VLLVELGVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATA 245

Human   187 QWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLN 251
            .:.:.|...:  ::..:..|.....:||.|..|.|||.:::..:|||||||:  ....|.|.|||
  Fly   246 TYIIDQLVNS--KDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRA--LFGICRGVDLN 306

Human   252 RNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHL--NEIKVYITFHSYSQMLLFPY 314
            |||...||....:.|||..:|.|.:..||.||:.:..|||..:  ..|:.:|:.||||||::|||
  Fly   307 RNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPY 371

Human   315 GYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAY-DLGIKHTFAFE 378
            |::::...|:.||..:.|:..:.:.......|..|.|..||||.||.|.|||: .|.|..||::|
  Fly   372 GHSAERVDNYHDLTDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYE 436

Human   379 LRDKGKFG--FLLPESRIKPTCRETMLAVKFIAK 410
            ||......  |:|....|:||..|...:::.|.:
  Fly   437 LRGPADSEDLFILSAKEIEPTAAEAFASIQTIVQ 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 19/91 (21%)
M14_CPB 114..413 CDD:199852 106/302 (35%)
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 14/73 (19%)
M14_CP_A-B_like 179..472 CDD:199844 106/297 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157645
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.