DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPA3 and CG8539

DIOPT Version :9

Sequence 1:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster


Alignment Length:355 Identity:93/355 - (26%)
Similarity:168/355 - (47%) Gaps:58/355 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    91 ILIHDLQE--EIEK------QFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGS 147
            |:::.|.|  |:.:      |.|            .|.:::.|:.:.:::...:...|:...:..
  Fly    14 IVVNQLSEAREVRRRRGLMLQLD------------NYLSYDGIMQYLDELALSHSNRVTLKDVAR 66

Human   148 TVEDNPL--YVLKIGEKNERRKAIFTDCGIHAREWVSPAFCQWFVYQATKTYGRNKIMTKLLDRM 210
            |.|:..|  .::..|:....::.||.|..:|:|||::||.....:::....:..|   :.||...
  Fly    67 TYENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDY 128

Human   211 NFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLNRNFNASWN-SIPNTNDPCADNYRG 274
            :::|:|:.|.|||.:|....|.||..|:.| ...|.||:|||||...|| ..|...|||.:||.|
  Fly   129 DWHIMPLANPDGYEYSRNTERYWRNTRTPN-GGNCFGTNLNRNFAVDWNVGFPELKDPCDENYAG 192

Human   275 SAPESEKETKAVTNFIRSHLNEIK---VYITFHSYSQMLLFPYGYTSKLPPN---HEDLAK---- 329
            |:|.||.|.:.|.:.:.. |.|.|   :|::.|:.::.:.:|:.|.:....|   |:::.:    
  Fly   193 SSPFSEVEARTVRDIMHG-LVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVAD 256

Human   330 --VAKIGTDVLSTRYETRY--IYGPIESTIYPISGSSLDWAYDLGIKHTFAFEL----RDKGKFG 386
              :...||.:.:.:| .:|  .:|          |:|:|:|...|...:|.||:    ||..::.
  Fly   257 RILQSTGTFIKTWQY-AKYAGTFG----------GTSMDYALLAGFPLSFVFEMSGTGRDHVEYK 310

Human   387 FLLPESRIKPTCRETMLAVK-FIAKYILKH 415
            |..|...|:....|:...:| |..|.|.|:
  Fly   311 FFPPARDIRHLAEESWTGIKAFAEKTIEKY 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 4/12 (33%)
M14_CPB 114..413 CDD:199852 85/320 (27%)
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 84/312 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157641
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.