DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPA3 and CG8560

DIOPT Version :9

Sequence 1:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_001261516.1 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster


Alignment Length:425 Identity:115/425 - (27%)
Similarity:215/425 - (50%) Gaps:24/425 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     1 MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMM 65
            |..:..|.|:..::|:|...:|..|::.:..::..:..::..|:.....||:....:...::.:|
  Fly     1 MLKLFAVVLLLASVALAVENYDGYKIYDINARNAFEKQLLLRLSGNEAYDFFDLPRSLDASSRVM 65

Human    66 VDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKED--------IPGRHSYAKYNNW 122
                |..::.:..:..|::..::|.::..:..|.:.::.|..::        .....|:..::..
  Fly    66 ----VKPEDQEGFEHLLEKYGVNYSVINENFGESLRQERDENQNQRLMNLRSAERSVSFKAFHRH 126

Human   123 EKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKI--GEKNERRKAIFTDCGIHAREWVSPAF 185
            .:|.|:.:::...||..||....|.:.|:..:..:.|  |:....:..:|.|.|||||||::.|.
  Fly   127 AEINAYLDELAAAYPSRVSVQVAGKSYENRDIKTITITNGDGKTGKNVVFLDAGIHAREWIAHAG 191

Human   186 CQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDL 250
            ..:.::|..:.:..|   ::||...::.||||.|.|||.:|.|..|||||.| |..:|.|.|||.
  Fly   192 ALYVIHQLVENFAAN---SELLKDFDWVILPVVNPDGYEYSHTTTRMWRKTR-KPISSACYGTDA 252

Human   251 NRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYG 315
            ||||:..|..:..::..|:|.::|....||.||:.:.:.:.|.....|.|:|.|||...||:|:|
  Fly   253 NRNFDFHWGEVGASSYSCSDTFKGETAFSEPETQLIRDILLSLTGRGKFYLTLHSYGNYLLYPWG 317

Human   316 YTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAYDLGIKH---TFAF 377
            :||.||.:..|..:||:.|.|.:.:...|:|..|...:.:|..:|.|.|:|:  |:.:   :...
  Fly   318 WTSALPSSWRDNDEVAQGGADAIKSATGTKYTVGSSTNVLYAAAGGSDDYAF--GVANFPVSITM 380

Human   378 ELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYI 412
            || ..|..||....|:|:....||.:.:|.:|:.:
  Fly   381 EL-PAGGTGFNPSTSQIEGFVSETWVGIKAMAQKV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 8/73 (11%)
M14_CPB 114..413 CDD:199852 99/304 (33%)
CG8560NP_001261516.1 Propep_M14 29..98 CDD:280416 8/72 (11%)
M14_CP_A-B_like 123..414 CDD:199844 98/297 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157642
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.