DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPA3 and CG18417

DIOPT Version :9

Sequence 1:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_648119.1 Gene:CG18417 / 38829 FlyBaseID:FBgn0035780 Length:427 Species:Drosophila melanogaster


Alignment Length:436 Identity:135/436 - (30%)
Similarity:207/436 - (47%) Gaps:47/436 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     3 LILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQA--DIIKDLAKT-------NELDFWYPGATH 58
            |.|..||..|.      :::..|::.|..:....|  :.:.:|.|.       :||:...||   
  Fly    13 LSLSAGLQRTN------KYEGYKIYEVSSEARSVAFSEALSELVKNASYYEVFSELNAGNPG--- 68

Human    59 HVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDI------PGRHSYA 117
                    ...|...|.......:::|.:.|:|:..::...:.:||:....:      .||....
  Fly    69 --------KIMVHPHEQVNFVQLMEENNVKYDIINRNVGLTLSRQFETNRMLRHWFPYNGRLGTE 125

Human   118 KYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKI--GEKNERRKAIFTDCGIHAREW 180
            :|.|.|:|..:.|.:..::|..|....:|.:.|...|..:.|  |:....:..|..|.|.|||||
  Fly   126 RYYNHEEINQFIEDLAGEHPRRVFLKTVGRSYEGRWLKTITITNGDARRNKNVILVDGGFHAREW 190

Human   181 VSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTK--NRMWRKNRSKNQNS 243
            :|||...:.:.|.  .|........||| .::.||||.|.|||.::...  .|||||.| |..:|
  Fly   191 ISPAAATYLINQL--VYNLEDNADLLLD-FDWVILPVVNPDGYEYTQLSEDTRMWRKTR-KPSSS 251

Human   244 KCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQ 308
            .|||||.||||:..||....::|||.:.|.|:.|.||.|...|.:.|.|:::..::|:|.|||..
  Fly   252 DCIGTDPNRNFDFHWNEEGASDDPCDNIYAGAKPFSEPEALVVGDLIHSYVDRGQMYLTLHSYGS 316

Human   309 MLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTI-YPISGSSLDWAYDLGIK 372
            ::|:|:|:|:.:|...|||.:||..|...:.....|.|..||..:|| |..||:|.|:|::.|..
  Fly   317 LILYPWGWTAAVPDTEEDLHEVAAAGQSAIQEATGTIYKIGPSATTINYAASGASDDYAFNAGFP 381

Human   373 HTFAFELRDKGKFGFLLPESRIKPTCRETMLAV-----KFIAKYIL 413
            .:|..|| ..|..||..|.|.|....:||.:.:     |.|.||.|
  Fly   382 ISFTMEL-PFGGTGFDPPASDIDSIVKETWVGIAAMARKVIQKYPL 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 13/82 (16%)
M14_CPB 114..413 CDD:199852 111/308 (36%)
CG18417NP_648119.1 Propep_M14 <65..99 CDD:280416 7/44 (16%)
M14_CP_A-B_like 127..420 CDD:199844 107/297 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157640
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.