DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPA3 and CG8562

DIOPT Version :9

Sequence 1:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster


Alignment Length:428 Identity:127/428 - (29%)
Similarity:203/428 - (47%) Gaps:30/428 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     5 LPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFR 69
            |.|..:..||..|...::..:::.|.|....|||::..|: ....||        ::...::...
  Fly     7 LLVLFLGATLVAAEQDYEGYRIYEVIPSTADQADLLHQLS-LQGYDF--------ISETRLLGHP 62

Human    70 ----VSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKE--------DIPGRHSYAKYNNW 122
                ||..:.:..|..::..||...::..:|...|.::|..::        ...||.|..:|...
  Fly    63 SRVIVSPAQLKHFQQLVEAEKMTLTLVNSNLGASIAEEFAQRQMQRLLAPITGKGRLSTERYYTH 127

Human   123 EKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKI--GEKNERRKAIFTDCGIHAREWVSPAF 185
            |:|:.:.:.:..::|..|....:|.:.|...|..:.|  |:....:|.||.|.|.|||||:|||.
  Fly   128 EEIINYIDDLAQRFPSRVFVKTVGWSYEQRVLKTITITNGDGKANKKVIFMDGGFHAREWISPAA 192

Human   186 CQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGY--IWSWTKNRMWRKNRS--KNQNSKCI 246
            ..:.:.|..:.:..|   ..||...::.|||:.|.|||  ..:.|..|||||.|.  ......|.
  Fly   193 VLYVIDQLVEQFEEN---AHLLKDYDWVILPLVNADGYEHTQTGTLARMWRKTRQPYTYAGQTCY 254

Human   247 GTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLL 311
            |.|.||||:..||....:::||||.|.|....||.||..|.:.:.|..:...:|:|.|||...||
  Fly   255 GADPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHSLADRGIMYLTLHSYGNYLL 319

Human   312 FPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAYDLGIKHTFA 376
            :|:|:||.||.|.|||..||:.|.:.:.....|.|.||...:.:|..:|:|.|:.|..|...:..
  Fly   320 YPWGWTSDLPENWEDLDAVARTGAEAIENATGTVYTYGSSTNVLYIAAGASDDYGYYAGFNVSIT 384

Human   377 FELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILK 414
            .||...|..||..|.:||.....||.:.::.:|:.:::
  Fly   385 MELPGAGSIGFNPPVTRIDEFVTETWIGIRAMAEKVIE 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 15/77 (19%)
M14_CPB 114..413 CDD:199852 104/304 (34%)
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416 15/77 (19%)
M14_CP_A-B_like 124..420 CDD:199844 103/298 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.