DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPA3 and CG8563

DIOPT Version :9

Sequence 1:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster


Alignment Length:446 Identity:122/446 - (27%)
Similarity:205/446 - (45%) Gaps:56/446 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     7 VGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTN--ELDFWYPGATHHVAANMMVDFR 69
            |||....:|.....::....:.|:..||.....:.|| :||  |||||.      :..|..| ..
  Fly    14 VGLAGLGIANNLAGYEGYTKYTVQHGDENAFKYMVDL-QTNDAELDFWL------LTRNSSV-LT 70

Human    70 VSEKESQAIQSALDQNKMHYEI-----LIHDLQ--------------EEIEKQFDVKEDIPGRHS 115
            ||.:.....:::|....:.||:     |:..||              ||.::....:.:.|.|.:
  Fly    71 VSPRRKTQFEASLSSLGVSYEMQPLMELMAALQANSSFADDNYDGEYEECQQDECEQAERPRRRT 135

Human   116 -------YAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNER---RKAIF 170
                   ::.|..:.:::::...:..:||:......:|.:.|...:..|.| ..|.|   |:..:
  Fly   136 RRQARGFFSHYPRYHEVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSI-SLNSRVRPRRVAY 199

Human   171 TDCGIHAREWVSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRK 235
            .....|.|||::   .|..:|.|.:.....:..|::|..:..:::|:.|.|||.::.|.:|.|||
  Fly   200 IQAATHGREWIT---TQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDGYEYTHTTDRFWRK 261

Human   236 NRSKNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY 300
            ||.:.....|.|.|:||||...||....:.:.|::.|.|:||.||.||.||..::..:.|.:|:.
  Fly   262 NRHRYAGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFNRNRVKLS 326

Human   301 ITFHSYSQMLLFPYGYT-SKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLD 364
            :..||:.:.:.:||||. :.:||....|..||....:.:.....|||..|...|.:|..|||..|
  Fly   327 LDVHSFGKFIFYPYGYAKNTVPPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYEASGSLDD 391

Human   365 WAY-DLGIKHTFAFEL-RDKGKFGFLLPESRIKPTCRETMLA-VKFIAKYILKHTS 417
            :|| :|||..::..|| .|:    |.:|...|...|:||... ::||     :|.|
  Fly   392 FAYGNLGIPLSYTLELPGDE----FHVPAHDIIHVCKETFAGFIEFI-----RHVS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 24/94 (26%)
M14_CPB 114..413 CDD:199852 90/312 (29%)
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 90/303 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.