DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPA3 and CG17633

DIOPT Version :9

Sequence 1:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_609310.2 Gene:CG17633 / 34297 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster


Alignment Length:422 Identity:132/422 - (31%)
Similarity:224/422 - (53%) Gaps:29/422 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     9 LIATTLAIAP--------VRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMM 65
            |:...|||..        ||:|..::::|..::.||.:::|||..:::...:..| .|.|.|::.
  Fly     7 LLFALLAIVASASVSAERVRYDNYRMYKVNSENAKQLEVLKDLEGSSDSIMFLDG-VHLVGADIQ 70

Human    66 VDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGR----HSYAKYNNWEKIV 126
            :  .|:..:.......|.::::.||:...|:|:.:: :.|.|..|.||    :::|:|...:...
  Fly    71 I--IVAPHKVPDFLEILGKSEIKYELQSRDVQKSLD-EIDEKVAIKGRATTAYNWAQYYELDDTY 132

Human   127 AWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKI---GE--KNERRKAIFTDCGIHAREWVSPAFC 186
            ||.:.:....|.:|:.|:.|.|.:...:..:||   ||  ..:.:..||.:.|||||||::||..
  Fly   133 AWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKAKPGIFLEAGIHAREWIAPAAA 197

Human   187 QWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLN 251
            .:.:.|...:...|  :.:|.:...:|:||..|.|||:::.|.||:|||.|:  ....|.|.|.|
  Fly   198 TFIINQLLTSEVEN--IKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRT--PYGSCFGADPN 258

Human   252 RNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGY 316
            ||:...||.:..::..|:|.|.|.:..||.||.:::.||.....::::|::.|:|||.||:|||:
  Fly   259 RNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGKVQLYLSLHAYSQYLLYPYGH 323

Human   317 TSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAYDL-GIKHTFAFELR 380
            ||.||.|..|..||.......::.||.|.|..|.|...|||.:|:|:||||.. .::..|.:|||
  Fly   324 TSDLPDNVADFEKVFDASIAAVNKRYGTTYTGGNIYDAIYPAAGASVDWAYGTQDVRMAFCYELR 388

Human   381 DKGK---FGFLLPESRIKPTCRETMLAVKFIA 409
            ....   .||.||..:|.|...|.:.::..:|
  Fly   389 PSSTSYLTGFKLPAEQIVPASEELLDSIVAMA 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 16/73 (22%)
M14_CPB 114..413 CDD:199852 104/305 (34%)
CG17633NP_609310.2 MpaA 7..374 CDD:225421 118/374 (32%)
Propep_M14 34..105 CDD:280416 16/74 (22%)
M14_CP_A-B_like 125..423 CDD:199844 103/300 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8518
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.