DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPA3 and CG7025

DIOPT Version :9

Sequence 1:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_609133.2 Gene:CG7025 / 34042 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster


Alignment Length:417 Identity:137/417 - (32%)
Similarity:230/417 - (55%) Gaps:28/417 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     5 LPVGLIATTLAIAP-------VRFDREKVFRVKPQDEKQADIIKDLAKTNE-LDFWYPGATHHVA 61
            ||:.|....||...       :|:|...|::||.:.:.|..|::.||:..| ...|:       .
  Fly     6 LPIVLALVVLAQGASFGQDERLRYDNYSVYKVKFETQAQRSILRKLAEDRENFRLWH-------E 63

Human    62 ANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEI--EKQFDVKEDIPGRHSYAKYNNWEK 124
            |...:...:|......:::.:.:..:..|:.|.::||.|  |:..::|....|...:.|||:..:
  Fly    64 AKDELHLMLSPGAFGELETEIQKTNVTAELFISNVQELIDSEEAANLKASRDGTFGWTKYNSLAE 128

Human   125 IVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREWVSPAFCQWF 189
            |.||.:.::..||.:.....:|.:.|...:..:||..|: ....:..:..||||||::.|...|.
  Fly   129 IYAWLDDILAAYPTITESFIVGQSYEGRTIRGIKISYKS-NNPGVLIESNIHAREWITSATATWL 192

Human   190 VYQ-ATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNSKCIGTDLNRN 253
            :.: .|.|   ::::..|.:..::||:||.||||::::..|:|||||.|..::.|.|||.|.|||
  Fly   193 INEFLTST---DELVRDLAENHDWYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRN 254

Human   254 FNASW--NSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGY 316
            :::.|  |...::| |||::|.|..|.||.|.:|::.|:.|..::|.|.:.||||||:||.|||:
  Fly   255 YDSHWMENEGASSN-PCAEDYGGPKPFSEPEIQAMSEFVISIKDKINVLLAFHSYSQLLLSPYGH 318

Human   317 T-SKLPPNHEDLAKVAK-IGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAY-DLGIKHTFAFE 378
            | .:.|||.:|:.:||| .|..|.|..|.|.|.||.....:||.||:::|||| :.|::.::..|
  Fly   319 TKEEFPPNFDDMMEVAKAYGDAVESLPYGTVYRYGSAAGILYPASGATIDWAYNEQGVEISYTIE 383

Human   379 LRDKGKFGFLLPESRIKPTCRETMLAV 405
            .||.|::||:||...|.|...|.::.:
  Fly   384 FRDTGRYGFILPPVHIIPNAEEALIGI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 15/76 (20%)
M14_CPB 114..413 CDD:199852 111/298 (37%)
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 14/73 (19%)
M14_CP_A-B_like 123..416 CDD:199844 110/293 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157648
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8518
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.