DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPA3 and CG18585

DIOPT Version :9

Sequence 1:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_001260213.1 Gene:CG18585 / 34041 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster


Alignment Length:426 Identity:138/426 - (32%)
Similarity:226/426 - (53%) Gaps:38/426 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     1 MRLILPVGLIATTLAIAPV---------RFDREKVFRVKPQDEKQADIIKDLAK-TNELDFWYPG 55
            |||:   .|:||.:|:...         |:|..:|:::..|::.|...|:.:.: |.:.:.|   
  Fly     1 MRLL---WLLATLVALTSAGILKDSPKERYDNFRVYKLTIQNKIQLAAIEKIGELTKKYNIW--- 59

Human    56 ATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYN 120
             ..:...:..:|..||..|....|..|..|.:..|::|.::||.|:::............:.||.
  Fly    60 -KEYDERSRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERIDEEQVTPTADSATFGWTKYY 123

Human   121 NWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREWVSPAF 185
            ..|:|.||.:::::.||.:.....:|.:.|...:..:||..| .....||.:..||||||::.|.
  Fly   124 ELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHK-AGNPGIFIESNIHAREWITSAS 187

Human   186 CQWFVYQATKTYGRNKIMT-------KLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKNQNS 243
            ..||:         |:::|       .|.|..:::|:|||||||:.:|..|:|||||.|..:..:
  Fly   188 ATWFI---------NQLLTSEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATN 243

Human   244 KCIGTDLNRNFNASWNSIPNTND-PCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYS 307
            .|||.|.||||::.|......:| ||::.:.|..||||.|.||:..::....::|.|||:||||.
  Fly   244 ACIGADANRNFDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYG 308

Human   308 QMLLFPYGYTS-KLPPNHEDLAKVAKIGTDVL-STRYETRYIYGPIESTIYPISGSSLDWAY-DL 369
            |.||.|||:|: :.|.|:.|:..:.|...|.: :..|.|.|.||.....:|..:|:|:||.: :|
  Fly   309 QYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNEL 373

Human   370 GIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAV 405
            |.|..:..|.||||::||:||..:|.|.|.|.|:.:
  Fly   374 GKKIGYTIEYRDKGRYGFILPPVQIIPNCEELMVGM 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 17/74 (23%)
M14_CPB 114..413 CDD:199852 111/303 (37%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 17/74 (23%)
M14_CP_A-B_like 122..415 CDD:199844 110/298 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157647
Domainoid 1 1.000 240 1.000 Domainoid score I2257
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8518
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.