DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPA3 and CG3097

DIOPT Version :9

Sequence 1:NP_001861.2 Gene:CPA3 / 1359 HGNCID:2298 Length:417 Species:Homo sapiens
Sequence 2:NP_572259.1 Gene:CG3097 / 31503 FlyBaseID:FBgn0029804 Length:445 Species:Drosophila melanogaster


Alignment Length:444 Identity:137/444 - (30%)
Similarity:230/444 - (51%) Gaps:44/444 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     1 MRLILPVGLIATTLA-------------IAPVRFDREKVFRVKPQDE---KQADIIKDLAKTNEL 49
            ::|:|.|..:|.:||             ..|.|:|..:::|:....|   |:..:.:.|.:....
  Fly     8 LQLLLLVAAVAASLANELPSNLTLLDANEIPQRYDEAQLWRIYNISEAMQKRVPVGQMLEQKFGG 72

Human    50 DFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIP--- 111
            :.|...       :..:|..::..:.:|.:|.|..:::..:||.|::|..|::  ::.|.|.   
  Fly    73 NIWKEN-------SKFLDISIARDQLKAARSFLSAHRLDPQILSHNIQSMIDE--ELLEGIQSSS 128

Human   112 ---GRHS---------YAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNE 164
               ||.:         :..|::.|.|.::..::..|:|.:|....||.|.|...|.||:|.|...
  Fly   129 FGHGRRTKKAARSSMHWKDYHDLETIYSFMREIRTKFPNIVRLYTIGQTAEGRDLKVLRISENPR 193

Human   165 RRKAIFTDCGIHAREWVSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTK 229
            ..|.::.|.|||||||:|||...:.:||....:.......:   .:.:||:||.|.|||.:|.|.
  Fly   194 ENKKVWIDGGIHAREWISPATVTFILYQLMSDWENQPAHIR---GLTWYIMPVMNPDGYEYSRTT 255

Human   230 NRMWRKNRSKNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHL 294
            ||:||||||.::.::|.|.||||||:..||...::.:||:|.||||||.||:||:||..|:....
  Fly   256 NRLWRKNRSPSRRAQCSGVDLNRNFDIGWNGYGSSTNPCSDTYRGSAPASERETRAVAEFLAKRK 320

Human   295 NEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPIS 359
            ..::.|:|||||.||:::|:.|.:....:...|.:|:.:..:.:..:..|.|........:....
  Fly   321 YNLESYLTFHSYGQMIVYPWAYKAVKVKDASVLQRVSSLAAERILQKTGTSYRAAVTHEVLGIAG 385

Human   360 GSSLDWA-YDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYI 412
            |.|.||: ..||:|:.:..||||:|.:||:||...||.|..|....|:.:|:.|
  Fly   386 GGSDDWSRAALGVKYVYTIELRDRGAYGFVLPPRFIKDTALEGWTVVETVAQAI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPA3NP_001861.2 Propep_M14 28..102 CDD:280416 14/76 (18%)
M14_CPB 114..413 CDD:199852 110/309 (36%)
CG3097NP_572259.1 Propep_M14 64..118 CDD:280416 11/60 (18%)
M14_CP_A-B_like 148..439 CDD:199844 109/293 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 244 1.000 Inparanoid score I3303
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm9821
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.