DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIM50 and IRC20

DIOPT Version :9

Sequence 1:NP_001268380.1 Gene:TRIM50 / 135892 HGNCID:19017 Length:487 Species:Homo sapiens
Sequence 2:NP_013348.1 Gene:IRC20 / 850949 SGDID:S000004237 Length:1556 Species:Saccharomyces cerevisiae


Alignment Length:317 Identity:70/317 - (22%)
Similarity:111/317 - (35%) Gaps:111/317 - (35%)


- Green bases have known domain annotations that are detailed below.


Human     6 SLPELEDR------LQCPICLEVFKEPLMLQCGHSYCKGCLVSLSCHLDAELRCPVCRQAVDGSS 64
            :|..|:|.      |.|.|||...:...:::|||.:||.|:::   .|.|..:||:|:    |..
Yeast  1223 NLSRLKDTLNDNQILSCSICLGEVEIGAIIKCGHYFCKSCILT---WLRAHSKCPICK----GFC 1280

Human    65 SLPNV----------SLARVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGS--H 117
            |:..|          ...:.|:..|..|....:...:..:.:|...|.::        |.|:  .
Yeast  1281 SISEVYNFKFKNSTEKREKEIQEPRREGADSSQDNSNENSIISNMSEVEK--------LFGNKYE 1337

Human   118 QHHPVTPVSTVYSRMKEELAA-------LIS--ELKQEQKKVDELIAKLVNNRTRIVNESDVFSW 173
            |.|.:..|..::  :||...|       |||  .||.||:..|.....|.:.:|..:.   |...
Yeast  1338 QFHQINEVHQIH--IKESFGAKIDFVIKLISYLRLKSEQENADPPQVILYSQKTEYLK---VIGK 1397

Human   174 VIRREFQELHHLVDEEKARCL-------EGIGGHTR----------------GL-------VASL 208
            |::     |:|:   |...||       |.|....|                ||       :..|
Yeast  1398 VLK-----LYHI---EHLACLSNTANVGETINNFKRQPSVTCLLLNVKTLGAGLNLINAKHIFLL 1454

Human   209 DMQLE-----QAQGTRERLAQAE---------------------CVLEQFGNEDHHK 239
            |..|.     ||.|...|:.|.|                     |:||:...::..|
Yeast  1455 DPILNNSDELQAMGRNNRIGQDEETFVWNFMIRNTVEENILRYKCILEERKRKEKSK 1511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIM50NP_001268380.1 RING-HC_TRIM50_like_C-IV 14..58 CDD:319519 16/43 (37%)
RING-HC finger (C3HC4-type) 16..56 CDD:319519 14/39 (36%)
BBOX 90..125 CDD:237988 6/36 (17%)
SPRY_PRY_TRIM50 283..469 CDD:293977
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..487
IRC20NP_013348.1 HepA 172..>568 CDD:223627
DEXQc_SHPRH 383..602 CDD:350828
RAD18 1234..>1327 CDD:227719 23/99 (23%)
RING-HC_RNF10 1239..1276 CDD:319450 14/39 (36%)
SF2_C_SNF 1356..1485 CDD:350180 32/139 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.