DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIM50 and Sce

DIOPT Version :9

Sequence 1:NP_001268380.1 Gene:TRIM50 / 135892 HGNCID:19017 Length:487 Species:Homo sapiens
Sequence 2:NP_477509.1 Gene:Sce / 43327 FlyBaseID:FBgn0003330 Length:435 Species:Drosophila melanogaster


Alignment Length:94 Identity:27/94 - (28%)
Similarity:41/94 - (43%) Gaps:27/94 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     3 WQVSLPELE---------------------DRLQCPICLEVFKEPLML-QCGHSYCKGCLVSLSC 45
            |::||.||:                     ..|.|||||::.|:.:.. :|.|.:|..|:|:...
  Fly    12 WELSLYELQRKPQEVITDSTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIVTALR 76

Human    46 HLDAELRCPVCRQAVDGSSSL---PNVSL 71
            ..:.|  ||.||:.:....||   ||..|
  Fly    77 SGNKE--CPTCRKKLVSKRSLRADPNFDL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIM50NP_001268380.1 RING-HC_TRIM50_like_C-IV 14..58 CDD:319519 16/44 (36%)
RING-HC finger (C3HC4-type) 16..56 CDD:319519 14/40 (35%)
BBOX 90..125 CDD:237988
SPRY_PRY_TRIM50 283..469 CDD:293977
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..487
SceNP_477509.1 RING 45..89 CDD:238093 16/45 (36%)
RAWUL 336..431 CDD:292824
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.