DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIM50 and SPCC548.05c

DIOPT Version :9

Sequence 1:NP_001268380.1 Gene:TRIM50 / 135892 HGNCID:19017 Length:487 Species:Homo sapiens
Sequence 2:NP_587745.1 Gene:SPCC548.05c / 2539314 PomBaseID:SPCC548.05c Length:468 Species:Schizosaccharomyces pombe


Alignment Length:99 Identity:28/99 - (28%)
Similarity:47/99 - (47%) Gaps:9/99 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     9 ELEDRLQCPICLEVFKEPLMLQCGHSYCKGCLVSLSCHLDAELRCPVCRQAVDGSSSLPNVSLAR 73
            :::..|:||||.|..:.|....|||:||..||::   .|.....||.|||.:....| |...:..
pombe    78 KIKKTLECPICTEALQRPFTTHCGHTYCYECLLN---WLKESKSCPTCRQKLYTQPS-PAYLVYE 138

Human    74 VIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELI 107
            ::..:.......|.|.: :.||    .:|.:|::
pombe   139 IMNVVAASNSGFPLVGI-NENP----AKKQKEVL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIM50NP_001268380.1 RING-HC_TRIM50_like_C-IV 14..58 CDD:319519 18/43 (42%)
RING-HC finger (C3HC4-type) 16..56 CDD:319519 16/39 (41%)
BBOX 90..125 CDD:237988 4/18 (22%)
SPRY_PRY_TRIM50 283..469 CDD:293977
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..487
SPCC548.05cNP_587745.1 RING 84..126 CDD:238093 19/44 (43%)
COG2888 <193..213 CDD:268082
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X48
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.