DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E4f1 and CG14667

DIOPT Version :9

Sequence 1:NP_001288713.1 Gene:E4f1 / 13560 MGIID:109530 Length:783 Species:Mus musculus
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:251 Identity:66/251 - (26%)
Similarity:109/251 - (43%) Gaps:44/251 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse   334 VHVQMQELPLGMKALTPES----PDSEELPCSSENSRENLLHQAMQNSGIVLER------VAGEE 388
            |||::...||..:.:..:.    .|.::..|......|   ||.::.  |.|:.      :|..|
  Fly    91 VHVELSSEPLDEQLIDADQLETHYDDDQYVCYQGTKEE---HQDLEE--IELDDDPSAAVIAAAE 150

Mouse   389 SALEPAPPSGSSPQCLGDGSPELPLLKVEQIETQVASEAATVPRTH--PCPQCSETFPTAATLEA 451
            :|.|.|                    :.|.::.| ..|.|...|::  .|.:|...|..|.....
  Fly   151 AAAEAA--------------------QQEDLQEQ-EMERAAKRRSNFFICDECGTLFHDAFLYTE 194

Mouse   452 HKRGHIAPRP----FTCTQCGKAFPKAYLLKKHQ-EVHVHERRFRCGDCGKLYKTIAHVRGHRRV 511
            |..||...|.    |.|.:|.:.|.|..|||:|: :||:..|||:|..|.:.:.::.....|.:.
  Fly   195 HLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKA 259

Mouse   512 HSDERPFPCPQCGKRYKTKNAQQVHFRTHLEE-KPHVCQFCSRGFREKGSLVRHVR 566
            |.:|||:||.:||..:.:.:..|.||.||.:: :...|:.|:..|..:..||.|.:
  Fly   260 HKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E4f1NP_001288713.1 Required for ubiquitin ligase activity. /evidence=ECO:0000250 40..84
Mediates dimerization, DNA-binding, transcription repression of CCNA2 and interaction with HMGA2. /evidence=ECO:0000250 185..264
COG5048 193..594 CDD:227381 66/251 (26%)
C2H2 Zn finger 195..215 CDD:275368
zf-C2H2 221..243 CDD:278523
C2H2 Zn finger 223..243 CDD:275368
zf-H2C2_2 235..258 CDD:290200
C2H2 Zn finger 251..269 CDD:275368
Mediates interaction with CDKN2A. /evidence=ECO:0000250 368..565 57/210 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 386..407 4/20 (20%)
Interaction with BMI1. /evidence=ECO:0000250 434..598 44/141 (31%)
C2H2 Zn finger 436..456 CDD:275368 5/19 (26%)
zf-C2H2 462..484 CDD:278523 9/22 (41%)
C2H2 Zn finger 464..484 CDD:275368 8/20 (40%)
C2H2 Zn finger 492..512 CDD:275368 3/19 (16%)
zf-H2C2_2 504..529 CDD:290200 9/24 (38%)
Mediates interaction with TP53. /evidence=ECO:0000250 520..579 14/48 (29%)
C2H2 Zn finger 520..540 CDD:275368 6/19 (32%)
zf-H2C2_2 534..555 CDD:290200 7/21 (33%)
C2H2 Zn finger 548..568 CDD:275368 6/19 (32%)
zf-H2C2_2 560..584 CDD:290200 3/7 (43%)
Mediates interaction with RASSF1. /evidence=ECO:0000250 574..596
C2H2 Zn finger 576..595 CDD:275368
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 5/19 (26%)
C2H2 Zn finger 211..232 CDD:275368 8/20 (40%)
C2H2 Zn finger 240..260 CDD:275368 3/19 (16%)
zf-C2H2_8 243..313 CDD:292531 20/69 (29%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 297..316 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5423
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.