DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX15 and Fdx1

DIOPT Version :9

Sequence 1:NP_001358953.1 Gene:COX15 / 1355 HGNCID:2263 Length:419 Species:Homo sapiens
Sequence 2:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster


Alignment Length:91 Identity:24/91 - (26%)
Similarity:35/91 - (38%) Gaps:12/91 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   258 LQLRRFA-HGTAGLVFLTALSGAFVAGLDAGLVYNSFPKM-GE-SWIPEDLFTFSPILRNVFENP 319
            |.|||.| |.:..|:.......||....:|  ::.:.|:. || .|  :|     |...:...|.
  Fly     4 LLLRRSAVHNSCKLISKQIAKPAFYTPHNA--LHTTIPRRHGEFEW--QD-----PKSTDEIVNI 59

Human   320 TMVQFDHRILGITSVTAITVLYFLSR 345
            |.|..|.:...:.......|||...|
  Fly    60 TYVDKDGKRTKVQGKVGDNVLYLAHR 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX15NP_001358953.1 COX15-CtaA 66..367 CDD:388555 24/91 (26%)
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.