DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SDHAF4 and Sirup

DIOPT Version :10

Sequence 1:XP_047274166.1 Gene:SDHAF4 / 135154 HGNCID:20957 Length:111 Species:Homo sapiens
Sequence 2:NP_609170.1 Gene:Sirup / 34089 FlyBaseID:FBgn0031971 Length:118 Species:Drosophila melanogaster


Alignment Length:106 Identity:26/106 - (24%)
Similarity:40/106 - (37%) Gaps:45/106 - (42%)


- Green bases have known domain annotations that are detailed below.


Human    10 LSWVSAT-AWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKP----------------KLPEGR 57
            :|::|.: ||||..|              ||  ::|.: :|:|                |.|.|:
  Fly    19 VSYLSTSGAWRATAS--------------GG--DMVVE-IKEPKTRTEKLMAFQKKLRAKTPLGK 66

Human    58 FDA-PEDSHLEKEPLENLSFAGRMSWLITVIPAFWKAEVGG 97
            .|. ....:.|||||:        .|.....|  :..|:||
  Fly    67 LDEFSRHPYQEKEPLK--------PWPNQTNP--YTGEIGG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SDHAF4XP_047274166.1 None
SirupNP_609170.1 DUF1674 73..118 CDD:429724 10/35 (29%)

Return to query results.
Submit another query.