DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX8A and COX8

DIOPT Version :10

Sequence 1:NP_004065.1 Gene:COX8A / 1351 HGNCID:2294 Length:69 Species:Homo sapiens
Sequence 2:NP_649328.1 Gene:COX8 / 40390 FlyBaseID:FBgn0263911 Length:68 Species:Drosophila melanogaster


Alignment Length:62 Identity:18/62 - (29%)
Similarity:29/62 - (46%) Gaps:11/62 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    15 SARRLPVPRAK---------IHSLPPEGKLGIME-LAVGLTSCFVTFLLPAGWILSHLETYR 66
            ||.||.||..:         :.|.||..::...| :.:|...|..:..:|| |:|.|:..|:
  Fly     5 SAARLLVPAMRSAMQSRCQSVVSGPPTQRISTAEKVILGGGMCAASLFIPA-WVLYHIRDYK 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX8ANP_004065.1 SIFI-degron. /evidence=ECO:0000269|PubMed:38297121 2..19 2/3 (67%)
Cyt_c_Oxidase_VIII 26..68 CDD:238470 12/42 (29%)
COX8NP_649328.1 Cyt_c_Oxidase_VIII 26..65 CDD:474920 11/39 (28%)

Return to query results.
Submit another query.