Sequence 1: | XP_006522949.1 | Gene: | Dscam / 13508 | MGIID: | 1196281 | Length: | 2034 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287018.1 | Gene: | dpr6 / 50296 | FlyBaseID: | FBgn0040823 | Length: | 396 | Species: | Drosophila melanogaster |
Alignment Length: | 209 | Identity: | 54/209 - (25%) |
---|---|---|---|
Similarity: | 87/209 - (41%) | Gaps: | 37/209 - (17%) |
- Green bases have known domain annotations that are detailed below.
Mouse 319 SPRKVKSSVGSQVSLSCSVTGNEDQELSWYRNGE--ILNPG-----KNVRITGLNHAN-----LI 371
Mouse 372 MDHMVKSDGGAYQC----------FVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSPAEPVSL 426
Mouse 427 VCNVKGTPLPT--VTWTLDDDPILKGSGHRISQMITSEGNV-VSYLNISSSQVRDGGVYRCTANN 488
Mouse 489 SAGVVLYQARINVR 502 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam | XP_006522949.1 | Ig | 15..115 | CDD:386229 | |
IGc2 | 239..300 | CDD:197706 | |||
IG | 320..400 | CDD:214652 | 25/101 (25%) | ||
Ig_3 | 410..488 | CDD:372822 | 22/80 (28%) | ||
IGc2 | 518..575 | CDD:197706 | |||
Ig | 596..686 | CDD:386229 | |||
Ig_DSCAM | 707..784 | CDD:143211 | |||
Ig | 802..889 | CDD:386229 | |||
FN3 | 885..978 | CDD:238020 | |||
FN3 | 986..1083 | CDD:238020 | |||
FN3 | 1091..1184 | CDD:238020 | |||
FN3 | 1189..1278 | CDD:238020 | |||
Ig_3 | 1301..1363 | CDD:372822 | |||
FN3 | 1380..1470 | CDD:238020 | |||
FN3 | 1486..1555 | CDD:238020 | |||
dpr6 | NP_001287018.1 | V-set | 79..174 | CDD:284989 | 25/103 (24%) |
IG_like | 80..175 | CDD:214653 | 26/103 (25%) | ||
IG_like | 184..271 | CDD:214653 | 22/86 (26%) | ||
IGc2 | 191..262 | CDD:197706 | 20/70 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |