DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam and dpr13

DIOPT Version :9

Sequence 1:XP_006522949.1 Gene:Dscam / 13508 MGIID:1196281 Length:2034 Species:Mus musculus
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:435 Identity:94/435 - (21%)
Similarity:148/435 - (34%) Gaps:113/435 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   285 PSDSGSYVCEVSNRYGTAKVIGRLYVKQPL--------KATISPRKVKSSVGSQVSLSCSVTGNE 341
            |:.||.|      |....:|:.||.....|        ...|......:|.|...:::.::|   
  Fly     2 PASSGLY------RIKNGRVLDRLQKPAALIFIIAYIAACGICDHTASASPGGGKTVAATMT--- 57

Mouse   342 DQELSWYRNGEILNPGKNVRITGLNHANLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGT 406
                         .|.....:..:|. ||||....:.:....          .|.|.|.....|.
  Fly    58 -------------TPASEPSVRHINQ-NLIMSQSKEGEPVPV----------PQPYAQSAASAGG 98

Mouse   407 PKIISAFSEKVVSPAEPVSLVCNVKGTPLPTVTWTLDDDPILKGSGHRISQMITSEG-------- 463
            ..|.|..|..|:.            |...||.|..  .:.:|:...|...|...:.|        
  Fly    99 SSITSFDSTNVID------------GQSQPTPTHL--QEAVLQTHSHSRIQAKDTAGPYPIPVHR 149

Mouse   464 --NVVSYLNISSSQVRDGG--------VYRCTANNSAGVVLYQARINVRGPASIRPMKN--ITAI 516
              .|.::|..::.  .:||        :|..|.|::  ||..|.......|.::..:..  ::.|
  Fly   150 PEPVENHLEANNG--IEGGMESLFGTPMYFGTENST--VVTTQIGATAHVPCTVHHIGEGVVSWI 210

Mouse   517 AGRDTYIHCRVIGYPYYSIKWYKNANLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQP 581
            ..:|  .|...:|...||       :...|:...:....:.||::..||.. |.|.|.|.|...|
  Fly   211 RKKD--YHLLTVGLTTYS-------SDERFSATHLKHSEDWTLQIKFVQLR-DAGVYECQVSTHP 265

Mouse   582 QLSTSQSVHVTV-------KVPP--FIQPFEFPRFSIGQRVFIPC-VVVSGDLPITITWQKDGRP 636
              .||..:|::|       ..||  ::.|        |..:.:.| ||.:.:....|.|..|.|.
  Fly   266 --PTSIFLHLSVVEARAEITGPPIRYLTP--------GSTLRLQCRVVQNTEASEYIFWYHDNRM 320

Mouse   637 IPASL--GVTID-NIDFTSS-LRISNLSLMHNGNYTCIARNEAAA 677
            |...:  |:.:. ..||.|| |.|......|:||:||:|.|...|
  Fly   321 INYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPA 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DscamXP_006522949.1 Ig 15..115 CDD:386229
IGc2 239..300 CDD:197706 5/14 (36%)
IG 320..400 CDD:214652 11/79 (14%)
Ig_3 410..488 CDD:372822 17/95 (18%)
IGc2 518..575 CDD:197706 13/56 (23%)
Ig 596..686 CDD:386229 27/89 (30%)
Ig_DSCAM 707..784 CDD:143211
Ig 802..889 CDD:386229
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig_3 1301..1363 CDD:372822
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
dpr13NP_001033956.2 V-set 180..276 CDD:284989 25/109 (23%)
IG_like 182..262 CDD:214653 19/91 (21%)
IG_like 285..362 CDD:214653 25/84 (30%)
IGc2 292..361 CDD:197706 23/76 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.