DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam and ImpL2

DIOPT Version :9

Sequence 1:XP_006522949.1 Gene:Dscam / 13508 MGIID:1196281 Length:2034 Species:Mus musculus
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:198 Identity:42/198 - (21%)
Similarity:80/198 - (40%) Gaps:37/198 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse   239 GQRVELPCKALGHPEPDYRWLKDNMP------LELSGRFQKTVTGLLIENSRP------SDSGSY 291
            |..:|:.|:.:|...|..:|:..::|      |:.:...::..:.::...|..      |::.:|
  Fly    73 GATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTY 137

Mouse   292 VCEVSNRYGTAKVIGRLYVKQPLKATISPRKVKSS----------------VGSQVSLSCSVTGN 340
            .|  ..|.|:..:.....|..|..:.::|.|....                :||.:.|.|.|...
  Fly   138 TC--VGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHAR 200

Mouse   341 EDQELSWY--RNGEILNPGKNVRITGLNHANLIMDHMVKSDGGAYQCFVRK--DKLSAQDYVQVV 401
            ...|::|.  .|.||:. |...|:  |.:.:|::..:...|.|.|:|..|.  .|.:|..:|..|
  Fly   201 PRAEITWLNNENKEIVQ-GHRHRV--LANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFVYPV 262

Mouse   402 LED 404
            |.:
  Fly   263 LNE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DscamXP_006522949.1 Ig 15..115 CDD:386229
IGc2 239..300 CDD:197706 13/72 (18%)
IG 320..400 CDD:214652 24/99 (24%)
Ig_3 410..488 CDD:372822
IGc2 518..575 CDD:197706
Ig 596..686 CDD:386229
Ig_DSCAM 707..784 CDD:143211
Ig 802..889 CDD:386229
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig_3 1301..1363 CDD:372822
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 19/66 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.