DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam and Lac

DIOPT Version :9

Sequence 1:XP_006522949.1 Gene:Dscam / 13508 MGIID:1196281 Length:2034 Species:Mus musculus
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:397 Identity:85/397 - (21%)
Similarity:139/397 - (35%) Gaps:123/397 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse   123 REPYTVRVEDQKTMR--GNVAVFKCIIPSSVEAYVTVVSWEKDTVSLVSGSRFLI---------- 175
            |.| |:....|:.::  |....|.|.:..:.|..|..:..:.|.|.|.:||..:|          
  Fly    27 RTP-TISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYD 90

Mouse   176 --TSTGALYIKDVQNED-GLYNYRCI--TRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRK 235
              :||..|.|||:|..| |.|..:.:  |.|:.:.|.:.|......:||  ||..|::       
  Fly    91 PNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISD--NSTQSVV------- 146

Mouse   236 AMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGRFQKTVTGLLIENSRPSDSGSYVCEVSNRYG 300
            |..|..|::.|.|.|:|.|...|.::|..:                  .|:||.:||        
  Fly   147 ASEGSEVQMECYASGYPTPTITWRRENNAI------------------LPTDSATYV-------- 185

Mouse   301 TAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGNEDQELSWYRNGEILNPGKNVRITGL 365
                                                                    |..:||..:
  Fly   186 --------------------------------------------------------GNTLRIKSV 194

Mouse   366 NHANLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSPAE-PVSLVCN 429
            .          |.|.|.|.| |..:.:|..|...:.:|.....:|:....::....: .:.|.|:
  Fly   195 K----------KEDRGTYYC-VADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECH 248

Mouse   430 VKGTPLPTVTWTLDDDPILKGSGHRISQMITSEGNVVSYLNISSSQVRDGGVYRCTANNSAGVVL 494
            ::..|.|.:.||.||..:.....:.||...|::....|.|.:.:.:.|..|.|.|.|.|..|.. 
  Fly   249 IEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEA- 312

Mouse   495 YQARINV 501
             :||:|:
  Fly   313 -EARVNL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DscamXP_006522949.1 Ig 15..115 CDD:386229
IGc2 239..300 CDD:197706 14/60 (23%)
IG 320..400 CDD:214652 11/79 (14%)
Ig_3 410..488 CDD:372822 19/78 (24%)
IGc2 518..575 CDD:197706
Ig 596..686 CDD:386229
Ig_DSCAM 707..784 CDD:143211
Ig 802..889 CDD:386229
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig_3 1301..1363 CDD:372822
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
LacNP_523713.2 IG_like 36..131 CDD:214653 25/94 (27%)
FR1 37..50 CDD:409353 2/12 (17%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 1/6 (17%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 5/13 (38%)
Ig strand C' 68..72 CDD:409353 2/3 (67%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 10/30 (33%)
Ig strand D 84..90 CDD:409353 0/5 (0%)
Ig strand E 94..102 CDD:409353 4/7 (57%)
Ig strand F 108..115 CDD:409353 2/6 (33%)
CDR3 116..124 CDD:409353 2/7 (29%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 29/175 (17%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 0/3 (0%)
Ig strand F 201..206 CDD:409353 2/5 (40%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 23/92 (25%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.