DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam and fipi

DIOPT Version :9

Sequence 1:XP_006522949.1 Gene:Dscam / 13508 MGIID:1196281 Length:2034 Species:Mus musculus
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:468 Identity:110/468 - (23%)
Similarity:195/468 - (41%) Gaps:109/468 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse   583 LSTSQSVHVTVKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQK-DGRPIPASLG-VTI 645
            ||.|.:.|..|:.             ..:.:.:.|  .|.|..:.:.|:. .|..|....| :.|
  Fly    25 LSLSPAEHSVVRY-------------TNESLIVQC--RSPDPKVELHWKSPKGEIIREHKGRIHI 74

Mouse   646 DNIDFTSSLRI--SNLSLMHNGNYTCIARNEAAAVEHQSQ---LIVRVPPKF-----VVQPRDQD 700
            :... |..|:|  ::::|...||::|    |||.....|:   |||.....|     |:..::.:
  Fly    75 EQTS-TEQLKIVFAHIALADKGNWSC----EAADGSLHSKSFDLIVYQKITFTENATVMTVKEGE 134

Mouse   701 GIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYL 765
                ||.|| |..:|.|.|.:.|.|:   |.|.....|.:.:.::|::| |||..|.:.|:|.|.
  Fly   135 ----KATIL-CEVKGEPQPNVTWHFN---GQPISAGAADDSKFRILADG-LLINKVTQNDTGEYA 190

Mouse   766 CKV--SNDVGADV---------------SKSMYLTVKIPAMITSYPNTTLATQGQRKEMSCTAHG 813
            |:.  .|.:.:|:               ||:.::::|.     :|.|.| ||      :.|.|..
  Fly   191 CRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKY-----AYINGT-AT------LMCEALA 243

Mouse   814 EKPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGII 878
            |.|....|.::...::.....|.:.:......:  |:.:|.|...|:  :.|.|.|    |.|.|
  Fly   244 EPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSL--TIHVLNTSAFDN--YRCRARN----DLGTI 300

Mouse   879 QLTV-----QEPPDPPEIEIKDVKART--ITLRWTMGFDGNSP--ITGY------DIECKNKSDS 928
            :.|.     ::||.|...:::...:.|  :.|....| ..:||  :.|:      ::|.|..:..
  Fly   301 ERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRG-PPDSPMGVNGFRIEYMTEMEFKTDAGK 364

Mouse   929 WDSAQRTKDVSPQLNSATII--DIHPSSTYSIRMYAKNRIGKSEPSNEITITADEAAPDGPPQEV 991
            |.:|:| ||.:.: ..||.:  ::.|.:.|.:|..::|..|.|:      .|..|..     :.:
  Fly   365 WTNARR-KDYAFE-EGATFLLTNLEPDTVYLVRAASRNLAGFSD------FTKVEKY-----KTL 416

Mouse   992 HLEPTSSQSIRVT 1004
            .|||..|..::.|
  Fly   417 SLEPRVSSGVKET 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DscamXP_006522949.1 Ig 15..115 CDD:386229
IGc2 239..300 CDD:197706
IG 320..400 CDD:214652
Ig_3 410..488 CDD:372822
IGc2 518..575 CDD:197706
Ig 596..686 CDD:386229 20/96 (21%)
Ig_DSCAM 707..784 CDD:143211 25/93 (27%)
Ig 802..889 CDD:386229 19/91 (21%)
FN3 885..978 CDD:238020 24/104 (23%)
FN3 986..1083 CDD:238020 5/19 (26%)
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig_3 1301..1363 CDD:372822
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
fipiNP_787975.1 IG_like 33..115 CDD:214653 21/101 (21%)
I-set 128..202 CDD:254352 24/82 (29%)
Ig 133..>193 CDD:299845 23/68 (34%)
IG_like 228..307 CDD:214653 22/98 (22%)
Ig 235..305 CDD:143165 19/83 (23%)
FN3 312..415 CDD:238020 26/116 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.