DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam and Fas2

DIOPT Version :10

Sequence 1:XP_006522949.1 Gene:Dscam / 13508 MGIID:1196281 Length:2034 Species:Mus musculus
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:774 Identity:192/774 - (24%)
Similarity:311/774 - (40%) Gaps:132/774 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse   422 EPVSLVCNVKGTPLPTVTWTLD-----DDPIL-KGSGHRISQMITS--EGNVVSYLNISSSQVRD 478
            :|:.|.|. ...|.|::...|.     ::.|| |.:|.....|.|.  .|..:: |.|:|..|..
  Fly    48 KPLILTCR-PTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLA-LMITSLSVEM 110

Mouse   479 GGVYRCTANNSAGVVLYQARINVRGPASI---RPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKN 540
            ||.|.||| :.|...:.:..:.::...:|   ...:|.....|:|..:.|.|...|..:|.|.:|
  Fly   111 GGKYYCTA-SYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRN 174

Mouse   541 ANLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFIQPFEFP 605
            .:.:...:.:...:.||.| :.:|| |.|||.|||...|   :.|.:.:..|::|..||||    
  Fly   175 GDPIRTTNDKYVVQTNGLL-IRNVQ-ESDEGIYTCRAAV---IETGELLERTIRVEVFIQP---- 230

Mouse   606 RFSIGQRVFIP--CVVVSGDLPITITWQKDGRPIP--------ASLGV-TIDNIDF---TSSLRI 656
                 :.:.:|  ...|.|. |........|:|:|        ..|.| |.|....   |..:.|
  Fly   231 -----EIISLPTNLEAVEGK-PFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGLVTI 289

Mouse   657 SNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTI 721
            |::|....|.|||:|:|.|..|:.:::|.|.|.|: :.:..:..|...|.:.:.|.|:|.|.|.|
  Fly   290 SSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQ-IYELYNVTGARTKEIAITCRAKGRPAPAI 353

Mouse   722 VWK-------FSKGAG--------VPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSND 771
            .::       ::.|..        .|.|.  ...|.    |.|:|.|.:....|.|.|.| ::.:
  Fly   354 TFRRWGTQEEYTNGQQDDDPRIILEPNFD--EERGE----STGTLRISNAERSDDGLYQC-IARN 411

Mouse   772 VGADVSKSMYLTVKIP---AMITSYPNTTLATQGQRKEMSCTAHGEKPIIVRWEKEDRIINPEMA 833
            .|||..|:.::||:..   :.:...| ...:.:.::..:||.|.|.....:.|....|.|..   
  Fly   412 KGADAYKTGHITVEFAPDFSHMKELP-PVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKD--- 472

Mouse   834 RYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPEIEIKDVKA 898
            .|..:.|.||....|.|.:.|..|:....:.|.|.|.:|.....:||.....||    .:.:.|.
  Fly   473 LYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPD----FVSEAKP 533

Mouse   899 RTITLRWTMGFD--GNS-----PITGYDIECKNK-SDSWDSAQRTKDVSPQLNSATIID-IHPSS 954
            ..:|.. ||.||  |.|     ||..|.::.|.. :..|.:|. .:..||  :|..|:: :.|.:
  Fly   534 SQLTAT-TMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAY-NRSWSP--DSPYIVEGLRPQT 594

Mouse   955 TYSIRMYAKNRIGKSE-PSNEITITADEAAPD------GPPQEVHLEPT----SSQSIRVTWKAP 1008
            .||.|..|:|::|... ..|:...|...:||:      .|.|....||.    .|....:.|..|
  Fly   595 EYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVP 659

Mouse  1009 KKHLQNG-IIRGYQIGY----------REYSTGGNFQFNIISIDTTGDSEVYTLDNLNKFTQYGL 1062
               ..|| .|..|||.|          .|.....|   .:..::||.    :.:..|...|.|.:
  Fly   660 ---ADNGEPIDRYQIKYCPGVKISGTWTELENSCN---TVEVMETTS----FEMTQLVGNTYYRI 714

Mouse  1063 VVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPESISISWSTLSKEALNGIL 1121
            .::|.|..|....:..|:.||         ..:..|..:...: .|.:.:...|:.|:|
  Fly   715 ELKAHNAIGYSSPASIIMKTT---------RGIDVIQVAERQV-FSSAAIVGIAIGGVL 763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DscamXP_006522949.1 Ig 26..121 CDD:472250
Ig strand B 42..46 CDD:409547
Ig strand C 55..59 CDD:409547
Ig strand E 79..83 CDD:409547
Ig strand F 99..104 CDD:409547
Ig strand G 112..116 CDD:409547
Ig 125..210 CDD:472250
Ig strand B 141..145 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 192..199 CDD:409353
Ig 235..310 CDD:472250
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..395 CDD:472250
Ig strand B 331..335 CDD:409353
Ig strand C 344..348 CDD:409353
Ig strand E 368..372 CDD:409353
Ig strand F 382..387 CDD:409353
Ig 406..501 CDD:472250 24/86 (28%)
Ig strand B 424..428 CDD:409353 1/3 (33%)
Ig strand C 437..441 CDD:409353 0/3 (0%)
Ig strand E 467..471 CDD:409353 1/3 (33%)
Ig strand F 481..486 CDD:409353 2/4 (50%)
Ig strand G 494..497 CDD:409353 0/2 (0%)
Ig 504..593 CDD:472250 24/91 (26%)
Ig strand B 521..525 CDD:409353 0/3 (0%)
Ig strand C 534..538 CDD:409353 1/3 (33%)
Ig strand E 557..561 CDD:409353 2/3 (67%)
Ig strand F 572..577 CDD:409353 3/4 (75%)
Ig strand G 586..589 CDD:409353 0/2 (0%)
Ig 596..686 CDD:472250 28/103 (27%)
Ig strand B 613..617 CDD:409353 1/5 (20%)
Ig strand C 627..631 CDD:409353 0/3 (0%)
Ig strand E 652..656 CDD:409353 0/3 (0%)
Ig strand F 666..671 CDD:409353 3/4 (75%)
Ig strand G 679..682 CDD:409353 0/2 (0%)
Ig_DSCAM 689..784 CDD:409397 25/109 (23%)
putative Ig strand A 689..693 CDD:409397 1/3 (33%)
putative Ig strand A' 698..702 CDD:409397 0/3 (0%)
putative Ig strand B 704..714 CDD:409397 2/9 (22%)
putative Ig strand C 720..726 CDD:409397 1/12 (8%)
putative Ig strand C' 733..736 CDD:409397 1/2 (50%)
putative Ig strand D 744..747 CDD:409397 0/2 (0%)
putative Ig strand E 749..755 CDD:409397 3/5 (60%)
putative Ig strand F 762..770 CDD:409397 3/7 (43%)
putative Ig strand G 775..784 CDD:409397 2/8 (25%)
Ig_DSCAM 785..884 CDD:409398 22/101 (22%)
putative Ig strand A 785..788 CDD:409398 0/5 (0%)
putative Ig strand A' 796..800 CDD:409398 0/3 (0%)
putative Ig strand B 803..810 CDD:409398 1/6 (17%)
putative Ig strand C 818..824 CDD:409398 1/5 (20%)
putative Ig strand C' 833..836 CDD:409398 0/2 (0%)
putative Ig strand D 842..846 CDD:409398 2/3 (67%)
putative Ig strand E 848..854 CDD:409398 2/5 (40%)
putative Ig strand F 861..869 CDD:409398 2/7 (29%)
putative Ig strand G 872..882 CDD:409398 3/9 (33%)
FN3 885..978 CDD:238020 28/102 (27%)
FN3 <937..1300 CDD:442628 47/208 (23%)
Ig_3 1287..1363 CDD:464046
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Fas2NP_001284854.1 Ig 33..121 CDD:472250 23/75 (31%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 1/3 (33%)
Ig strand E 99..103 CDD:409353 1/4 (25%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 21/71 (30%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 3/4 (75%)
Ig strand F 204..209 CDD:409353 3/4 (75%)
IgI_4_MYLK-like 229..319 CDD:409568 26/99 (26%)
Ig strand A 229..232 CDD:409568 2/11 (18%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 0/4 (0%)
Ig strand F 298..306 CDD:409568 5/7 (71%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 24/100 (24%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/5 (40%)
Ig 447..515 CDD:409353 19/70 (27%)
Ig strand B 447..451 CDD:409353 0/3 (0%)
Ig strand C 460..464 CDD:409353 0/3 (0%)
Ig strand E 487..491 CDD:409353 2/3 (67%)
Ig strand F 501..506 CDD:409353 1/4 (25%)
FN3 525..619 CDD:238020 28/101 (28%)
FN3 640..735 CDD:238020 23/104 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.