DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam and dpr9

DIOPT Version :9

Sequence 1:XP_006522949.1 Gene:Dscam / 13508 MGIID:1196281 Length:2034 Species:Mus musculus
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:248 Identity:58/248 - (23%)
Similarity:87/248 - (35%) Gaps:84/248 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse    85 PFPPSSFS---TLIHDNTYY--CTAENPSGK--------IRSQDVHIKAVLREPYTVRVEDQKTM 136
            |:...:||   |.:...|.|  |..:|...|        :|.:|:|:..|.|..||   .||:  
  Fly   256 PYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYT---SDQR-- 315

Mouse   137 RGNVAVFKCIIPSSVEAYVTVVSWEKDTVSLVSGSRFLITSTGALYIKDVQNED-GLYNYRCITR 200
                  |:.|.....|.::                         |.||..|:.| |:|..:..| 
  Fly   316 ------FRAIHQPQTEDWM-------------------------LQIKYPQHRDSGIYECQVST- 348

Mouse   201 HRYTGETRQSNSARLFVSDPAN---SAPSILDGFDHRKAMAGQRVELPCKALGHPEPD--YRWLK 260
                 ....|:...|.|.:|:.   .||.:.       ..:|..:.|.|.....|||.  ..|..
  Fly   349 -----TPHMSHYIHLNVVEPSTEIIGAPDLY-------IESGSTINLTCIIQNSPEPPAYIFWNH 401

Mouse   261 DN-MPLE---------------LSGRFQKTVTGLLIENSRPSDSGSYVCEVSN 297
            :| .|..               ::.:...|.:.|||:::||||||.|.|..||
  Fly   402 NNAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGHYQCNPSN 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DscamXP_006522949.1 Ig 15..115 CDD:386229 10/42 (24%)
IGc2 239..300 CDD:197706 23/77 (30%)
IG 320..400 CDD:214652
Ig_3 410..488 CDD:372822
IGc2 518..575 CDD:197706
Ig 596..686 CDD:386229
Ig_DSCAM 707..784 CDD:143211
Ig 802..889 CDD:386229
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig_3 1301..1363 CDD:372822
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
dpr9NP_001287332.1 Ig 263..361 CDD:299845 29/139 (21%)
IG_like 263..360 CDD:214653 29/138 (21%)
IG_like 371..464 CDD:214653 24/91 (26%)
IGc2 377..456 CDD:197706 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.