DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drd1 and Octbeta1R

DIOPT Version :9

Sequence 1:NP_001278730.1 Gene:Drd1 / 13488 MGIID:99578 Length:446 Species:Mus musculus
Sequence 2:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster


Alignment Length:327 Identity:126/327 - (38%)
Similarity:187/327 - (57%) Gaps:18/327 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    23 ILTACF-LSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIA 86
            :...|| :..:||:.:|||.||..:|:|.|.||. :||:||:||||:|:|||:..|.:.|...|:
  Fly   107 VFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRI-ITNYFVVSLAVADMLVALCAMTFNASVMIS 170

Mouse    87 GFWPFGS-FCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFQYERKMTPKAAFILISVAWTLS 150
            |.|.||| .|::|.:||:..|||||::||.||||||:||..|..|...||.:..||::.:.|...
  Fly   171 GKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSP 235

Mouse   151 VLISFIPVQLSWHKAKPTWPLDGNFTSLEDAEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYT 215
            .|:||:|:...|:....      |:..|: :....|:.::::.|||.||.:||:||..:|:..|.
  Fly   236 ALLSFLPICSGWYTTTE------NYKYLK-SNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYY 293

Mouse   216 SIYRIAQKQIRRISALERAAVHAKNCQTTTGNGNPVECSQSESSFKMSFKRETKVLKTLSVIMGV 280
            .||:.|.:|.|.:...:.||:..:.....:....|....|.|.|...:.:||.|..:||.:||..
  Fly   294 RIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSA 358

Mouse   281 FVCCWLPFFISNCMVPFCGSEETQPFCI-DSITFDVFVWFGWANSSLNPIIYA-FNADFQKAFST 343
            |:.||||||:...:...|.|      || ..:...:..|.|:.||:||||||| ||.||:.||..
  Fly   359 FLICWLPFFLWYIVSSLCDS------CITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKK 417

Mouse   344 LL 345
            .|
  Fly   418 TL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drd1NP_001278730.1 7tm_1 39..331 CDD:278431 111/293 (38%)
7tm_4 40..>157 CDD:304433 57/117 (49%)
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 58/119 (49%)
7tm_1 124..404 CDD:278431 111/293 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.