DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAAR9 and dop-1

DIOPT Version :9

Sequence 1:NP_778227.3 Gene:TAAR9 / 134860 HGNCID:20977 Length:348 Species:Homo sapiens
Sequence 2:NP_001370620.1 Gene:dop-1 / 180714 WormBaseID:WBGene00001052 Length:460 Species:Caenorhabditis elegans


Alignment Length:391 Identity:107/391 - (27%)
Similarity:155/391 - (39%) Gaps:105/391 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    35 LYAVLGFGAVLAAFGNLLVMIAILHFKQLH-TPTNFLIASLACADFLVGVTVMPFSTVRSVESCW 98
            |::||   .:||.||||||..|||..:.|. .|.|..:.|||.:|.||.|.||.|:.|..:...|
 Worm    11 LFSVL---IILALFGNLLVCAAILWDRSLRKQPENLFLVSLAVSDLLVSVLVMLFAAVNDILGYW 72

Human    99 YFGDSYCKFHTCFDTSFCFASLFHLCCISVDRYIAVTDPLTYPTKFTVSVSGICIVLSWFFSVTY 163
            .||..||:|...||.:.|.||:.:||.||:|||..::.|:.|............|||.|..|...
 Worm    73 PFGQFYCQFWISFDITTCTASILNLCAISLDRYWHISRPMVYIRYCNRRRINYVIVLVWLISAGI 137

Human   164 SFSIFYTGANEEGIEELVVALTCVGGCQAPLNQNWVL-LCFLLFFIPNVAMVFIYSKIFLVAKHQ 227
            ..:....|.   |.:..:..||.:..|:..|...:.: ...:.||:|.:.||.:|:|::|.|:..
 Worm   138 GAAPLGFGF---GSKVTINNLTGLPVCEMRLPLPYAIGSSMVSFFLPAMVMVILYTKLYLYARKH 199

Human   228 ARKIESTASQA------QSSSESYKERVA------------------------------------ 250
            .|.|::...||      |.:||..:|..|                                    
 Worm   200 VRSIKTQLQQATSFLIMQLASEKIREVTAATLKGEALLPPDSPATERTTMTVSRHYSRRSTTTTT 264

Human   251 ------------------------------------KRER-------------------KAAKTL 260
                                                |.:|                   ||..||
 Worm   265 TATPRRGDKKTSSQNKVESIRTSIFSKLNFLCPTRFKNQRSPQDPHTPAAHNRSNISDQKARLTL 329

Human   261 GIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILVWCVYYNSAMNPLIYAFFYQWFGKAIKLI 325
            |:.|..|||.|||:....::.|::..|........:.|..|.||:.|||||:.|.:.|.:|.|.|
 Worm   330 GVIMGTFLVCWLPFFTVNILRAWLPEIFSSKTIMAVTWLGYANSSANPLIYSIFNRDFRRAFKKI 394

Human   326 V 326
            :
 Worm   395 I 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAAR9NP_778227.3 7tm_4 43..>271 CDD:304433 85/326 (26%)
7tm_1 49..311 CDD:278431 94/360 (26%)
dop-1NP_001370620.1 7tmA_Ap5-HTB1-like 7..391 CDD:320193 104/385 (27%)
TM helix 1 8..32 CDD:320193 13/23 (57%)
TM helix 2 42..64 CDD:320193 11/21 (52%)
TM helix 3 80..102 CDD:320193 9/21 (43%)
TM helix 4 125..141 CDD:320193 5/15 (33%)
TM helix 5 167..190 CDD:320193 5/22 (23%)
TM helix 6 326..348 CDD:320193 10/21 (48%)
TM helix 7 359..384 CDD:320193 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.