DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr1 and NC2beta

DIOPT Version :9

Sequence 1:NP_080382.2 Gene:Dr1 / 13486 MGIID:1100515 Length:176 Species:Mus musculus
Sequence 2:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster


Alignment Length:171 Identity:105/171 - (61%)
Similarity:133/171 - (77%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 SGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPE 69
            |..||:||:|||:|||:|||.:|.|||||::|||::|||:||||||||||||:||...||||:.|
  Fly    12 SAEDDELTLPRASINKIIKELVPTVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAE 76

Mouse    70 HVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQA 134
            ||::|||.|||..|..|.:.||.:||.||.|||:.|:||||||||||||||||||||||||::||
  Fly    77 HVLEALERLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAREEQA 141

Mouse   135 ELAQQEWLQMQQAAQQAQLAAASASASTQAGSSQDEEDDDD 175
            ...||:|:.||.||...:...|..|.:::.....|::||||
  Fly   142 REEQQQWMSMQAAAMVQRPPLADGSVASKPSEDDDDDDDDD 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dr1NP_080382.2 H4 7..130 CDD:304892 86/122 (70%)
Nuclear localization signal. /evidence=ECO:0000255 100..103 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176 7/24 (29%)
NC2betaNP_609736.1 H4 15..135 CDD:304892 84/119 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839268
Domainoid 1 1.000 114 1.000 Domainoid score I6079
eggNOG 1 0.900 - - E1_COG5150
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38809
Inparanoid 1 1.050 220 1.000 Inparanoid score I3553
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55130
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004284
OrthoInspector 1 1.000 - - oto93702
orthoMCL 1 0.900 - - OOG6_103431
Panther 1 1.100 - - LDO PTHR46138
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R797
SonicParanoid 1 1.000 - - X3019
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.