DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG10300

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster


Alignment Length:280 Identity:60/280 - (21%)
Similarity:117/280 - (41%) Gaps:13/280 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72
            |.|:....|:.|.||......:.|..::..:...|.:. ..||:..||.|||..:|...|..|..
  Fly     8 LDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLK-APTDEQLILAFLRRCRFSQEETKRRF 71

Human    73 AQYFEYRQQNLDMFKSFKATDPGIKQALKDG---FPGGLANLDHYGRKILVLFAANWDQSRYTLV 134
            ..|:..|....::..| :..|..:...|:.|   .|  :..:...|.::::....|.|..:....
  Fly    72 DNYYSLRSVFPEVLGS-RQVDEALLTQLQRGIHVIP--MRPVSPEGPRVIISQFRNIDPKKSNPR 133

Human   135 DILRAILLSLEAM-IEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGI 198
            :..:.|.:.||.: :|.....::|.:.::|..:.|.:|..:..|.:|:.|...:....|.||..|
  Fly   134 EAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEI 198

Human   199 HFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGM--LPPYDMGTW 261
            |.:|.......::..:..||..|...:..:|..: ..|:|.:..:::..|:||.  .....:..|
  Fly   199 HMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKS-EDLYQHLPRDVMTIEYGGTNGYQAEAVDHW 262

Human   262 ARTLLDHE--YDDDSEYNVD 279
            .:.|||.:  ...|::|..:
  Fly   263 RQKLLDSKDYLAKDAQYGTN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 106..251 CDD:238099 27/145 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
CG10300NP_651174.2 SEC14 95..251 CDD:238099 31/158 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145897
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.