DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG10301

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster


Alignment Length:267 Identity:63/267 - (23%)
Similarity:105/267 - (39%) Gaps:47/267 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72
            |||...:.|..|:||.||.:.|||..:|..:..:|.:. .|||..|::.|||..::...|..|.:
  Fly     5 LSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLR-ARTDVDFLIAFLRRCRYSLEETKRRI 68

Human    73 AQYFEY-------------RQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAA 124
            .:||.:             .|:.||:.:.      |:  .|....|.|    |......:..| .
  Fly    69 DRYFTHYNLFPEIMNNRCVTQRLLDINRM------GV--CLYPDMPKG----DSRSAMFIARF-G 120

Human   125 NWDQSRYTLVDILRAILLSLEAM-IEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQ 188
            ::|.:.|.|.:|.....:::|.: :|:....:.|...|||.......:..:....:.|.....|.
  Fly   121 HFDPNLYMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLY 185

Human   189 DSFPARFGGIHFVNQPWYIHA----LYTVIR-----PFLKEKTRKRIFLHGNNLNSLHQLIHPEI 244
            :..|.:...::.:|.|..|..    ||.|:.     |....|..:.:..|          |..|.
  Fly   186 NCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVLKNSEELIEH----------IGKES 240

Human   245 LPSEFGG 251
            ||.|:||
  Fly   241 LPEEYGG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 14/45 (31%)
SEC14 106..251 CDD:238099 30/154 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 14/46 (30%)
CRAL_TRIO 114..248 CDD:279044 30/145 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145898
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.